(data stored in ACNUC30630 zone)

EMBL: AP009256.PE271

AP009256.PE271       Location/Qualifiers
FT   CDS_pept        360601..362034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0271"
FT                   /product="hypothetical protein"
FT                   /note="COG family: methyl-accepting chemotaxis protein"
FT                   /note="Orthologue of BL0322"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39052"
FT                   /db_xref="UniProtKB/TrEMBL:A1A019"
FT                   /protein_id="BAF39052.1"
FT                   /translation="MVEQFPIVLRGYDKDRVDEAFASAQETVNRLREQVKADDQTILEL
FT                   QAQLQEEKNKKAAPKSFASLGANAQQMLASAEQTSAELLERAKKDASAARATVQLQAET
FT                   LLNNAKIDAKRIMDDANAKAAKVLGDAKDESEAMRANAQHEVDQMRSEAQKAVVAQRQT
FT                   VDLELTNSREEHGKRLAAERATQEREISDMRTEATSKIAEQRKNANEEISRLKSETNDQ
FT                   IESALAEANKKLADVREQVSKMMTDAQRRAAEITDTAKAKAQEITDEAEVHRTKTISQV
FT                   NAEVEQIRADISAQQEEATKKVNELLTDLNERREAANKQASELISSAQKTRDEAEAYAS
FT                   SKRDEADANAASILKQATEDADEQINERREAAKKELDGVQQRIADLQSREAQITQRVSE
FT                   LRAMFSNAFSGFGMNDLSVVNAVDEGEPSDAQSDDDAQHDDETAAPADADTQDAVENDS
FT                   AAETEPEGDAESADASQNN"
     atggttgagc agttcccaat cgtgttgagg gggtacgaca aggatcgagt cgacgaggcg        60
     ttcgcttcgg ctcaggagac ggtgaaccgt ctgcgtgagc aggtcaaggc cgacgaccag       120
     accatccttg agctgcaggc gcagctgcag gaggaaaaga acaagaaggc cgctccgaag       180
     tccttcgcgt cactgggcgc caacgcccag cagatgctcg ccagcgcgga acagaccagc       240
     gccgagctgc ttgaacgagc caagaaggac gcttccgcgg cccgcgccac ggtgcagctg       300
     caggctgaaa cactgctgaa caacgccaaa atcgacgcca agcgcatcat ggacgacgcc       360
     aacgccaagg cggccaaggt gctcggtgac gccaaggacg aatccgaagc catgagggcc       420
     aatgcccagc atgaggtcga ccagatgcgc agcgaggccc agaaggccgt ggtggcgcag       480
     cgtcagaccg tcgatctgga actgaccaac tcccgtgagg aacacggcaa gcgtcttgcc       540
     gccgaacgcg ccacgcagga acgtgagatt tccgacatgc gcaccgaggc gaccagcaag       600
     atcgccgaac agcgcaagaa cgccaatgag gagatctccc gcctgaagag cgagaccaac       660
     gaccagatcg aatccgcgct tgccgaagcc aacaagaagc tggcggacgt gcgcgagcag       720
     gtgtccaaga tgatgaccga cgcgcagcgc cgtgccgccg aaatcaccga caccgccaag       780
     gcgaaggccc aggagatcac cgacgaggcg gaggtgcacc gcaccaagac catcagccag       840
     gtcaacgccg aagtggagca gatccgcgcc gacatctccg cccagcagga ggaggccacg       900
     aagaaggtca atgagctgct caccgacctg aacgagcgtc gcgaggccgc caacaagcag       960
     gccagcgagt tgatttcctc cgcgcagaag acccgtgacg aggctgaggc gtacgcttcc      1020
     agcaagcgtg acgaggcgga cgcgaacgcg gcaagcatcc tcaagcaggc caccgaagac      1080
     gccgacgagc agatcaacga gcgtcgtgag gccgcgaaga aggaactgga cggcgtgcag      1140
     cagcgcatcg ccgacctgca gagccgtgag gcccagatca cgcagcgcgt cagcgaactg      1200
     cgtgccatgt tctccaacgc gttctccggt ttcggcatga acgacctgtc cgtggtcaac      1260
     gccgtcgatg aaggcgagcc ttccgacgcg caatctgatg acgacgcgca gcacgacgat      1320
     gagaccgccg caccggcaga cgccgacacg caggatgccg tcgagaacga ttccgcagcc      1380
     gagaccgagc cggaaggcga cgccgaatcc gcagacgctt cgcagaacaa ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page