(data stored in ACNUC30630 zone)

EMBL: AP009256.PE282

AP009256.PE282       Location/Qualifiers
FT   CDS_pept        373897..374838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0282"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type Mn_Zn transport
FT                   system_periplasmic Mn_Zn-binding (lipo)protein (surface
FT                   adhesina)"
FT                   /note="Orthologue of BL1126"
FT                   /note="PFAM_ID: Lipoprotein_4"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39063"
FT                   /db_xref="GOA:A1A030"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A1A030"
FT                   /protein_id="BAF39063.1"
FT                   /translation="MMDSPKHEAYENGGTIVNRYARIAIAVLASVGLLTSASACGTSQN
FT                   GAGSAHGAISVVSSINQWGTLAEQLGGSGVQVTSIINSTNVDAHDYEPTTSDIAKLQKA
FT                   RIVIVNGAGYDSWAVKAAQSAKSQVINAAEIGGVKDGGNPHVWFSAAVRKAVAQAITRA
FT                   YEGTRPDGKADFDKLNQQWRSKEDEVARKITETKRKADGEAYAATESVAEYLAGDLGLK
FT                   DATPTGYMRATANESEPTPTDIKQFTDMLEAGKVGLLVVNIQEETELTGKIVTAAKSSN
FT                   IPIVELTEQMPEQYDSLTDWMAALVDAFSQAI"
     atgatggatt caccgaagca tgaagcgtat gaaaatggag gaaccatcgt gaaccgttat        60
     gcaagaattg cgattgccgt actcgcttcc gtcggccttc tcacttccgc gtctgcctgc       120
     ggaacgtcgc agaacggtgc cggttccgcg catggcgcga tttccgtcgt ctcctccatc       180
     aaccaatggg gcaccctcgc cgagcagctc ggcggaagcg gcgtgcaggt gaccagcatc       240
     atcaactcca ccaacgtgga cgcgcacgac tatgagccga ccacgtccga catcgccaaa       300
     ctgcagaagg cacgaatcgt catcgtcaac ggcgccgggt acgactcatg ggccgtcaaa       360
     gccgcgcaat ccgccaaatc gcaagtcatc aacgcggcgg agatcggtgg cgtcaaggat       420
     ggcggcaacc cgcacgtctg gttctcggcg gcggtgcgca aagcggtcgc acaggccatc       480
     accagggcat acgagggcac aaggcccgac ggcaaggccg atttcgacaa gctgaaccag       540
     caatggcgtt ccaaggaaga cgaggtcgcc cgaaaaatca cggagaccaa acgcaaggcg       600
     gatggcgaag cctatgccgc cacggaatcg gtcgccgaat atttggccgg ggacctgggc       660
     ctcaaagacg cgacgccgac cggctacatg cgtgccacgg ccaacgaaag cgagccaacg       720
     ccgaccgaca tcaaacagtt caccgacatg ctggaggccg gcaaggtcgg cctgctggtg       780
     gtcaacattc aggaggagac cgagttgacc ggcaagatcg tcaccgccgc caaatcgtcc       840
     aatattccga tcgtggagct gaccgagcag atgccggagc agtacgattc cctgacggac       900
     tggatggccg cgctcgtcga cgcgttctcc caagccatct aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page