(data stored in ACNUC30630 zone)

EMBL: AP009256.PE286

AP009256.PE286       Location/Qualifiers
FT   CDS_pept        377968..379473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0286"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1551"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39067"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A1A034"
FT                   /protein_id="BAF39067.1"
FT                   /translation="MSEDRRMTRQWTVKVDGNNVKTLHDGESVEIGRKPLRPLSDDGFA
FT                   RLDIMDPGKSMSKRHAVLSVDKQGNCSVRDLHSTNGSFVVTNNGQLMRLPAGEDIKLPI
FT                   DSMTLQFGDVRLTLESAFEHDDEDDDATSGVSDDTSQPVSNLFEYAVSDEAPQEPDAAD
FT                   MSVDDILNLRAGEPTTFFHARNVTDRADALHQAERQTFTPEHADKPELEDAFPSVSLVQ
FT                   ETVVAADKPRDLFADAAAQAEAEAEIEADAADSADAAATDAEVAAVSTETAAQPLEASH
FT                   DGNKNNLIPVDKLFSARPSTPIAVALPDRNDTGDNTGNVDKADNAADASAQEQTQSAEQ
FT                   SQMAEQPTSETAEQQPAEQQSKPMHATQPQTEQPGTVTAEDDDERFRPQNSQSQPAPDE
FT                   TAAFKPIFEPGSVFDRVSKGGLAKQEQTIEVDGLTSDDAKRTDDFTVQFQMARHPELLP
FT                   FLAMNPSLYDDLYAWLGALGNQDIDAALAHNPGYEEYRKAVGK"
     gtgagcgagg atcgacgaat gacgcggcag tggaccgtca aagttgacgg aaacaacgtg        60
     aaaacgcttc atgacggcga aagcgtggaa atcgggcgca aaccgttgcg cccgctgtcg       120
     gatgacgggt tcgctcgtct cgacatcatg gatccgggca agtccatgtc gaaaagacat       180
     gcggtcctct ccgtcgacaa gcagggcaat tgctccgtac gagatctgca ttccaccaac       240
     ggctcgttcg tggtgacgaa caacggccaa ctgatgcgcc tgcccgcagg cgaggacatc       300
     aagctgccca tcgactcgat gaccctgcag ttcggcgacg tgcgtcttac gctcgaatcc       360
     gcattcgaac acgatgacga ggatgacgac gccacctccg gtgtctcgga tgatacaagc       420
     cagccggttt cgaacctgtt cgaatacgcg gtctccgacg aggctccgca ggaaccggat       480
     gcagccgaca tgtccgtgga cgacatcctc aatctgcgtg ccggcgagcc gacgacgttc       540
     ttccacgcgc gcaatgtcac cgaccgtgcc gatgctctgc accaggcgga acgtcagacc       600
     ttcacgccgg agcatgccga caagccggaa ctcgaagatg cattcccctc ggtctccttg       660
     gttcaggaaa ccgtcgtggc cgcggacaag ccccgcgacc tgttcgccga cgccgcagcg       720
     caggccgagg ctgaagctga gatcgaggcc gatgcggccg attccgctga tgcggctgcg       780
     accgatgccg aggtggctgc cgtctcaacc gagacagccg ctcagccctt ggaagcatcc       840
     catgacggta acaagaacaa cctgattccg gtggacaagc tgttcagcgc gcgccccagc       900
     acgccaatcg ccgtcgctct gcccgacagg aacgacactg gcgataacac aggcaacgtt       960
     gacaaggctg acaatgcggc tgacgcgtcc gcccaggaac agacgcagtc cgccgaacaa      1020
     tcgcagatgg cggaacagcc cacatcggaa acggccgaac agcagcccgc cgaacagcag      1080
     tcgaagccga tgcacgctac gcagccgcag acggaacagc cgggaacggt gaccgcggaa      1140
     gacgacgacg agcggttccg cccgcaaaac agccaatcgc agcccgcgcc ggacgaaacc      1200
     gccgcattca agccgatctt cgaaccggga tcggtattcg accgtgtgtc caaaggcggc      1260
     ctcgccaagc aggagcagac catcgaggtc gacggcctga cctccgatga cgccaaacgc      1320
     acggatgatt tcacagtgca gttccagatg gcgcgtcatc cggaactgtt gccgttcctc      1380
     gccatgaacc catccctata cgatgacctg tacgcgtggt tgggcgcatt gggcaaccaa      1440
     gacatcgatg cggctttggc acacaatccg ggatatgagg aataccgcaa ggcagtaggg      1500
     aagtga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page