(data stored in ACNUC30630 zone)

EMBL: AP009256.PE289

AP009256.PE289       Location/Qualifiers
FT   CDS_pept        complement(384596..385216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0289"
FT                   /product="hypothetical protein"
FT                   /note="COG family: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="Orthologue of BL1555"
FT                   /note="PFAM_ID: 5-FTHF_cyc-lig"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39070"
FT                   /db_xref="GOA:A1A037"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1A037"
FT                   /protein_id="BAF39070.1"
FT                   /translation="MDMCKQQRELKRHWRAAAIERRKRTSADQRREAGRLLAEHALEAS
FT                   LIRPRSTVAAFASMGSEISMMPLLEAMFDTDCRVLVPRLGAGMEVGWSELNGLDDLRDQ
FT                   RNADGSINTHRPQEPENAAEGPEVLTSAELIIVPAFAVDEHGFRLGRGGGWYDRALEHR
FT                   SSTARVVAVCWPWEPTDETVPHEPHDIPVDGVLTPDGYADVRG"
     atggacatgt gtaagcaaca acgcgagctg aaacggcatt ggcgcgcggc tgcgatcgaa        60
     cgacgaaagc ggacgtccgc cgaccagcgt cgcgaagcgg gacggctgct tgccgaacac       120
     gcattggaag cgtcgttgat tcgaccgcga tcgaccgtcg cggccttcgc ctcgatgggc       180
     agtgaaatat cgatgatgcc gttgctcgaa gcgatgttcg acacggattg ccgtgttttg       240
     gtgccgcgtc tgggtgctgg catggaagtc ggctggagtg agctgaacgg tcttgacgat       300
     ctgcgcgacc agcgcaatgc tgatggttcc atcaacacac atcgcccgca ggagccggaa       360
     aacgcagcgg aaggaccgga agttctcact tcggccgagc tgatcattgt gccagcgttc       420
     gctgtggacg aacatggttt ccgattgggg cgcggcggcg gttggtacga ccgcgctttg       480
     gagcatcgta gcagcaccgc gcgcgtggtc gccgtttgct ggccttggga gccgaccgac       540
     gagaccgtgc cgcatgagcc gcatgatatt cccgtcgacg gcgtgctcac gccggatggt       600
     tatgccgatg tccgaggata g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page