(data stored in ACNUC30630 zone)

EMBL: AP009256.PE312

AP009256.PE312       Location/Qualifiers
FT   CDS_pept        complement(411915..412271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39093"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A1A060"
FT                   /protein_id="BAF39093.1"
FT                   /translation="MKNPPLHRYATRPGLYFTDDGGADAVVRSETADQVWFCVLEPLDQ
FT                   PSAFYADAARLFNEPGLTFIDQAKKQRICTRRIPSLNLRETLFRMDGPNYGLWYVHVPQ
FT                   AWDGMQYGYRVNGP"
     atgaagaacc cacctttgca ccgctacgca acccgcccag gtctctattt caccgacgat        60
     ggtggcgcgg acgccgttgt ccgctcagaa acagcagacc aagtgtggtt ttgcgtactt       120
     gaaccacttg accaaccgag cgccttctat gccgacgccg cacggctgtt caacgaaccc       180
     ggactcacgt tcatcgatca ggccaaaaaa cagcgcatct gcaccagacg cattccctcg       240
     ctcaatcttc gcgaaacact gttccgcatg gacggtccca actacggact gtggtacgtg       300
     cacgtgccgc aagcatggga cggcatgcaa tacggatacc gcgtcaacgg cccatag          357
//

If you have problems or comments...

PBIL Back to PBIL home page