(data stored in ACNUC30630 zone)

EMBL: AP009256.PE375

AP009256.PE375       Location/Qualifiers
FT   CDS_pept        complement(472876..474030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0375"
FT                   /product="AraJ-like protein probably involved in transport
FT                   of arabinose polymers"
FT                   /note="COG family: arabinose efflux permease"
FT                   /note="Orthologue of BL1652"
FT                   /note="PFAM_ID:sugar_tr"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39156"
FT                   /db_xref="GOA:A1A0C3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0C3"
FT                   /protein_id="BAF39156.1"
FT                   /translation="MKRSILALASGAFILGAAEFVMMGILPQTATAMHVSIPAAGHYIS
FT                   AYAIGVCVGTLILVFGRKVPPKHLIILFMAIALVGNTLSAVSFCSPMLLVARFISGLPH
FT                   GAFFGTATLIAKTLADKGKEAQSVSMMVMGQTVANMLGVPAGTLLAEAMSWRLAFAILA
FT                   AWALMTIVVVISWVPSIDPIKDAGIKGQFRFLTHPGPWLILLAVFFGNSGIFCWWSYVS
FT                   PWLQKTGGWSATMVPMLMVLAGLGMVVGGIVGGRLTDLWKAGATAALSHGIALCGLLLV
FT                   FLLPGNHATTALLTFIIGFALFFNSSPQQLLMVQAGEGGGELIAGAAVQIAFNFGNAIG
FT                   SIVGGAALTATAMNYHFTGIAGAPISLLAVILLVLYTRRYEARA"
     atgaagagaa gcattctggc gctggcctcc ggcgccttca tcctcggcgc cgccgaattc        60
     gtgatgatgg gcatcctgcc ccagacggcc accgccatgc atgtcagcat tcccgcggcc       120
     ggccattaca tctccgcata cgccatcggc gtgtgtgtcg gcacactgat cctggtgttc       180
     ggccgcaagg tgccgccgaa gcatctcatc atcctgttca tggccatcgc gttggtcggc       240
     aacacgctca gcgccgtctc cttctgctcg ccgatgctgc tggtggcgcg tttcatttcc       300
     ggcctgccgc atggcgcgtt cttcggcacg gccacgctga tcgccaaaac gcttgccgac       360
     aagggcaagg aggcgcaatc cgtgtccatg atggtgatgg gccagacggt ggccaacatg       420
     ctgggcgtgc ccgcgggaac gttgctcgcc gaggcgatgt cctggcggct ggcgtttgcg       480
     attctggccg cctgggcgct tatgacgatc gtcgtggtga tttcgtgggt gccgtccatc       540
     gatccgatca aggacgccgg catcaagggg cagttccgct tcctcaccca tcccggcccg       600
     tggctgattc tgctggccgt gttcttcggc aattcgggca tcttctgctg gtggagctac       660
     gtgtcgccgt ggttgcagaa aaccggcgga tggtcggcga cgatggtgcc gatgctgatg       720
     gtgctcgccg gcctcggcat ggtggtcggc ggcatcgtgg gcggcaggct gaccgacctg       780
     tggaaggcgg gcgcgaccgc ggcgctatcg cacggcatcg ccttgtgcgg actgttgctg       840
     gtcttcctgt tgcctggtaa tcatgcgacc accgcgttgc tgacgttcat catcggtttc       900
     gcgctgttct tcaattcatc gccacagcaa ctgctgatgg tgcaggcggg cgaaggcggc       960
     ggcgagctga ttgccggtgc cgccgtacaa atcgccttca atttcggcaa tgcgatcggt      1020
     tccatcgtcg gcggagcggc actgaccgcg acggcgatga attaccattt caccggcatc      1080
     gcaggcgcgc cgatcagcct gctcgccgtc atcctgctgg tgctctacac ccgtcgctac      1140
     gaagcccgcg cctag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page