(data stored in ACNUC30630 zone)

EMBL: AP009256.PE382

AP009256.PE382       Location/Qualifiers
FT   CDS_pept        complement(482737..482991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0382"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL1659"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39163"
FT                   /db_xref="GOA:A1A0D0"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0D0"
FT                   /protein_id="BAF39163.1"
FT                   /translation="MKFAPIIDPSVRKPSPKPVRVDLRKVFTFGTALWAIALVICMILL
FT                   AFGINVERLQTMCAAGTVIGVLMLVWEHFDRWDYRRLGE"
     atgaaatttg ctccgattat cgacccaagc gtgcgcaaac cctcccccaa accggtgcgc        60
     gtcgacctgc ggaaggtgtt cacgttcggc accgcattat gggccatcgc cttggtgatc       120
     tgcatgattc tgctggcctt cggcatcaat gtcgaacgat tgcagaccat gtgcgccgcc       180
     ggcacggtga tcggcgtgct catgctggtt tgggagcatt tcgaccggtg ggactaccgc       240
     cgtcttggcg aataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page