(data stored in ACNUC30630 zone)

EMBL: AP009256.PE393

AP009256.PE393       Location/Qualifiers
FT   CDS_pept        493590..495755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0393"
FT                   /product="nucleoside-diphosphate-sugar epimerase and GAF
FT                   domain"
FT                   /note="Orthologue of CAC0731"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39174"
FT                   /db_xref="GOA:A1A0E1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E1"
FT                   /protein_id="BAF39174.1"
FT                   /translation="MRRVEILLIGNTDFVTKQWIEHAFPHDKVVVALRKGTESSGEDLK
FT                   IIDMPDRDAMSEVFSNYEFDRIVYFSEDLTPRSERDGDLGYLRRLLHTVRNRKVQMLMV
FT                   SGPESEFTYPQETDVHETSKSLMSRAGEELGLYYARTYDLEVKIVRCPYLYAPQRNGVT
FT                   AYFNGLFEQAQAGELRFHERAEQRTCFLCADDLAELIYRIFDDWTADSELFHVPNVFDF
FT                   TYGDLGTLIAGYFPGTKVVYGEDRPQAYPADDHELRLRYGFSPRYSLREDFPHVIEGWL
FT                   KLRENKTDKHPVWDFLRSHNKWWTVLEIIGAFLLTEWLRTFTQGNSQLETVDLRLLFVV
FT                   IVGTIYGLHAGVFAAVLACAGVAMSYASQGASFAPLFYDTSNWLAFVIYFVAGSVCGYV
FT                   QSRNQESVRFVRDENGLLRNRLDFLRGLYQDMLDDRRQLRDQIIGRRDSFGKLYAVTRE
FT                   LDEVQPQKLYHTAIRIMQESLDSDSLAIFRVDNGGQFARLVAASPRFDVGSFRSVRVSD
FT                   YGEIITALEHNGIWVNRTLKDKFPMYAVGVRDRGELAVIITMGEAKPDQMNLYFQNLFS
FT                   IMCGLVESAMIRAFEYEDVARRSMLVPGTNLLKPEAFLPKVLAANDLKHDHMGDHLLLK
FT                   VECEGNLEDVDSLLMQSIRQTDEAGMLTDDGVYLLMNQAGEKELPIILKRLTRSGLHCS
FT                   YVPQTQEDALLSEARSHIAQADDGGES"
     gtgaggcgag tggagatact gttaatcggc aacaccgact tcgtgacgaa gcagtggatc        60
     gagcacgcgt tcccccacga caaggtggtg gtggccctcc gcaaagggac cgaatccagc       120
     ggcgaggatc tcaaaatcat cgacatgccc gaccgtgacg ccatgtcgga agtgttctcc       180
     aactacgaat tcgatcgaat cgtctacttc tccgaagatc tgacgcctcg cagcgaacgt       240
     gacggcgacc tgggctacct gcgccgactg ctgcacaccg tccgcaatcg caaggtccag       300
     atgctgatgg tgagcgggcc ggaatcggaa ttcacctatc cgcaggaaac ggacgtgcac       360
     gagaccagca aaagcctgat gtcgcgtgcc ggcgaagagc tcggcctgta ctatgcgcgc       420
     acctacgatc tggaagtgaa gatcgtgcgc tgcccctatc tgtacgcgcc gcaacgcaat       480
     ggcgtcaccg catatttcaa cggcttgttc gaacaggcac aagcgggaga actgcgcttc       540
     catgaacgcg ccgaacaacg cacctgcttc ctatgcgccg acgatctggc cgaacttatc       600
     taccgcatat tcgacgactg gaccgccgac agcgagctgt tccacgttcc gaacgtgttc       660
     gacttcactt acggcgattt gggaacgctg atcgcgggat attttccggg aacgaaggtc       720
     gtatacggcg aggaccgtcc gcaggcatac cccgccgacg accacgaatt gcgattgcgg       780
     tacggctttt cgccacgata ctcgcttcgc gaggattttc cgcacgtcat cgaaggctgg       840
     ttgaagctcc gcgagaacaa aaccgacaag catccggtat gggatttcct acgcagccac       900
     aacaaatggt ggaccgtgct ggaaatcatc ggcgcgttcc tgctgacgga atggctccgc       960
     acttttacac aaggcaacag ccagctggaa accgtggacc tgcgattgct gttcgtggtg      1020
     atcgtcggca ccatctacgg gctgcatgcc ggcgtgttcg cagccgtact ggcctgcgcc      1080
     ggcgtggcca tgtcctacgc gtcgcagggc gcgtccttcg ccccgttgtt ctacgacaca      1140
     tcgaactggc ttgccttcgt catttatttc gtggccggat cggtatgcgg ctatgtgcag      1200
     tcgcgcaacc aggagagcgt gaggttcgtg cgcgacgaga acgggttgtt gcgcaatcgt      1260
     ctggacttcc tgcgcgggct gtatcaggat atgctcgacg accgcagaca gttgcgcgac      1320
     cagatcatcg gcagacgcga cagtttcggc aaactgtacg ccgtgacccg agaattggac      1380
     gaagtgcaac cgcagaagct gtaccatacg gcgatccgca tcatgcagga aagcctcgat      1440
     agcgacagcc tcgccatctt ccgagtggac aacggcggac agttcgcccg tcttgtggcg      1500
     gcgagcccac ggttcgacgt cggcagcttc cgctccgtac gcgtctcgga ttacggtgaa      1560
     atcatcaccg cgctggaaca caacggcata tgggtgaacc gaacgttaaa ggacaaattc      1620
     ccgatgtacg ccgtcggcgt gcgtgaccgt ggcgaactgg ccgtgatcat caccatggga      1680
     gaggccaaac cggaccagat gaacctgtac ttccagaatc tgttcagcat catgtgcggt      1740
     ctggtcgaat cggccatgat cagggccttc gaatacgagg acgtggcgcg ccggtccatg      1800
     ctggtgccgg gaacgaacct gctgaagcca gaagcgttcc tgccgaaggt gctggctgcc      1860
     aacgacctca aacacgacca tatgggcgac catctgctgc tcaaagtcga atgcgaggga      1920
     aaccttgagg acgtggactc cctgctgatg caaagcatcc gccagaccga tgaggccggc      1980
     atgctgacgg atgacggcgt gtatctgctg atgaaccagg cgggggagaa ggaactgccg      2040
     atcatcctca aacgtctgac ccgttccggc ttgcactgct cctacgttcc gcagacccaa      2100
     gaggatgccc tgctttccga agcccgatcg catatcgcgc aagccgacga tgggggtgaa      2160
     agctga                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page