(data stored in ACNUC30630 zone)

EMBL: AP009256.PE397

AP009256.PE397       Location/Qualifiers
FT   CDS_pept        499957..501435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0397"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of CAC0735"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39178"
FT                   /db_xref="GOA:A1A0E5"
FT                   /db_xref="InterPro:IPR031617"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E5"
FT                   /protein_id="BAF39178.1"
FT                   /translation="MAGIGFELKKLFHRKGLVAMVRAYGYAGVICTGPMLLGILLQFGV
FT                   LAVSGWWHVPRADQNLLVCMITYTLLASLVLTSFLSMPVTRFLADMLFEHHEETILPSF
FT                   WGSTTLMLAVGAVLYAVFLLFSGATLMQGLLCLWLFLEMIVNWNAMSYLTAIKDYQGIM
FT                   WSFVAAVVVAFLSACAMMALGLPQVESLLAAVAFGYGVMMVWDVVLLHRYFPQSSESPW
FT                   TFLAWLDRFLPLALTGLLTTLGLFSHLVITWCGPLGVHVKGLFYGAPYYDVPALLAFLT
FT                   ILITTVNFVVSVEVNFYPKYRAYYALLNDGGTVKDIVVAEREMLAVLNRELYYTALKQL
FT                   FVTAAVISLEKMVLGVLPLGFNDGMHGYFRVLCVGYALYAVGNTMLMILLYFTDYFGAV
FT                   CCAAIFAGSATVLTVISQFVPVTLMGFGFLLGASAFLLAAVVRLAVFTDNLPYRVLGAQ
FT                   PIVATEKRGWFTKLGEALDEFGERLHGTFGRKES"
     atggcgggaa tcggattcga actcaagaaa ctgttccacc gcaagggcct ggtcgccatg        60
     gtgcgcgcct acggttatgc cggtgtgatc tgcaccggac cgatgctgct gggcatcctg       120
     ctgcagttcg gcgtgctggc ggtcagcggt tggtggcacg tgccccgcgc ggaccagaat       180
     ctgctggtct gcatgatcac gtacacgctg ctcgcctcat tggtgttgac cagcttcctg       240
     tccatgccgg tgacgcgttt ccttgcggac atgctgttcg aacatcatga ggagaccatt       300
     cttccatcgt tctggggatc cacgaccctc atgctggcgg tgggtgcggt gctgtacgcg       360
     gtgttcctgc tgttttccgg cgcgaccctc atgcaggggt tactctgcct atggctgttc       420
     ctggaaatga tcgtcaattg gaatgcgatg agctatctga cggccatcaa ggattaccaa       480
     ggcatcatgt ggtcgttcgt cgcggcggtg gtcgtggcgt tcctgtccgc atgcgcgatg       540
     atggcgctgg gcctgccgca ggtggaaagc ctgctggccg cagtggcgtt cggctacggc       600
     gtgatgatgg tctgggacgt ggtgctgctg caccggtatt tcccgcaaag ctcggaaagc       660
     ccgtggacgt tcctcgcatg gctggaccgg ttcctgccgc tcgccctgac gggactgctg       720
     accaccctcg gcttgttctc ccacttggtg atcacctggt gtggtccgct tggcgtgcat       780
     gtgaagggac tgttctacgg tgccccctac tatgatgtgc ccgcgttact ggcgttcctg       840
     acgattctga tcaccaccgt gaatttcgtg gtgtcggtgg aagtcaattt ctatccgaaa       900
     taccgtgcct actacgcgct gctcaacgac ggcggcaccg tgaaggacat cgtggtggcc       960
     gaacgcgaga tgctcgccgt gctcaaccgt gagctgtact acaccgcgtt gaagcagctg      1020
     ttcgtcaccg cggcggtcat ctcgttggaa aagatggtgt tgggcgtgct gccgctcggt      1080
     ttcaacgatg gcatgcatgg ttatttccgt gtgctgtgcg tcggatacgc cctgtacgcg      1140
     gtcggcaaca ccatgctgat gattctgctg tatttcactg attacttcgg cgcggtgtgc      1200
     tgcgccgcga tattcgccgg gtcggccacg gtcttgactg ttatttcgca gttcgttccg      1260
     gtcacgctga tgggattcgg cttcctgctg ggcgcgtcgg cgttcctgct ggccgcggtc      1320
     gtgcgattgg cggtgttcac cgacaatctg ccgtatcgtg tgctcggcgc gcagccgatt      1380
     gtggcgaccg aaaagcgcgg atggtttacg aaactgggcg aagcgttgga cgaattcggc      1440
     gaacggctgc atggaacttt cggacggaag gaatcatga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page