(data stored in ACNUC30630 zone)

EMBL: AP009256.PE407

AP009256.PE407       Location/Qualifiers
FT   CDS_pept        512324..513835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0407"
FT                   /product="hypothetical secreted protein with D-Ala-D-Ala
FT                   carboxypeptidase 3 (S13) domain"
FT                   /note="COG family: D-alanyl-D-alanine
FT                   carboxypeptidase(penicillin-binding protein 4)"
FT                   /note="Orthologue of BL1679"
FT                   /note="PFAM_ID: Peptidase_S13"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39188"
FT                   /db_xref="GOA:A1A0F5"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0F5"
FT                   /protein_id="BAF39188.1"
FT                   /translation="MFRGDPYGADGEKMTKRGCGLAMDDAGDYRYTRRRRAITVAVSVV
FT                   ATVALCVGYAVADMCDVVPGVLTLRHVEHSTAAAAGRSIEAADVIADIDASKTIDPAAA
FT                   RALTDAFRASAAGFGGEFSIAIADASGNVVAENNIDVPRTPASTMKTLTAYAAAVELDM
FT                   GKTLDTQTYLEQSQDGTARLALKGNGDMLLGAGASDANHINGRAGLGTLAGRTAQALRQ
FT                   RGITSVTLAYDDTLFGNDRWPQGIAELDTDHLYYAPTASMAVDGGRNWNGTGPANPDVF
FT                   SAYPALSMQPARDAALVFQQRLAEQGITVQGFVSQGTVAGASHPLASVRSASLNEIMAF
FT                   TMRHSDNSLAEEFGRLLALQVGADNSPAGAVQAVKSVLERKGITTTGLDMRNCSGLTED
FT                   SKLTARTLLEVQLRNLAAGSGAAAAEGMSVMGFVGTAESRLNDADEAGLIRVKTGSLGD
FT                   VTSMTGNVSRLNGGALTFAVIVNNPTDFAAAKAAIDTFVAGLPKL"
     atgtttcgtg gcgatccata cggtgcggat ggtgaaaaga tgacgaagag agggtgtggt        60
     ttggctatgg atgacgctgg cgattaccgc tatacgcgac gacgccgagc aatcacggtg       120
     gcggtttccg tcgtggccac cgtcgcactg tgcgtcggct atgcagtggc cgacatgtgc       180
     gatgtcgtac cgggcgtcct cacattgcgc catgtcgaac attcgacggc cgccgctgcc       240
     ggccgttcga tcgaggcggc cgacgtgatc gccgacatcg acgcttccaa gaccatcgat       300
     ccggccgctg cgcgcgcgct gaccgacgcg ttccgagcct cagccgccgg cttcggcggc       360
     gaattctcca tcgccatcgc cgacgcgtcg ggcaacgtgg tcgcggaaaa caacatcgac       420
     gtgccccgca cgccagcatc caccatgaaa acgttgacgg cgtatgcggc cgccgtcgaa       480
     ctcgacatgg gcaagaccct ggacacgcag acctatctgg aacagtccca ggacggcacc       540
     gcgcggctgg cgctcaaagg caacggcgac atgctgttgg gagccggagc gtccgacgcg       600
     aaccacatca acggacgtgc cggattgggc acgcttgccg ggcggaccgc acaggcgttg       660
     cggcagcgtg gcatcacctc cgtgacattg gcttatgacg acacactgtt cggcaacgac       720
     cgctggccgc aaggcatcgc cgaactcgac acggaccacc tgtactacgc cccgacagct       780
     tccatggccg tggacggcgg caggaattgg aacgggacag gtccggccaa tcctgatgtg       840
     ttctcggcgt atccggcatt gagcatgcag ccggcgcgtg acgcggcgct ggtgttccag       900
     cagcggctgg ccgaacaggg catcacggtt cagggatttg tatcgcaagg cacggttgcg       960
     ggggcatccc atccgcttgc ctccgtgcgt tcggcgtcgt tgaacgagat tatggcgttc      1020
     accatgcggc attccgacaa ttcgctcgcc gaggaattcg gcaggctgct ggcgttgcag      1080
     gtcggcgcgg acaattcgcc ggctggcgcg gtgcaggctg taaaaagcgt gctggagcgc      1140
     aaaggcatca ctacgaccgg gctcgacatg cgcaattgtt cgggacttac ggaggattcg      1200
     aaactgacgg cgcgcaccct gctcgaagtg caactgcgca atctggctgc gggatcgggg      1260
     gcggccgcag ccgaaggaat gtccgtcatg ggcttcgtcg gcaccgctga gagccgtctg      1320
     aacgatgctg acgaagcggg gctgatccgt gtgaaaaccg gcagtctggg cgacgtgacc      1380
     tccatgaccg gcaatgtgtc gcggttgaac ggcggagcgt tgaccttcgc ggtgatcgtc      1440
     aacaatccca ccgatttcgc ggcggcgaag gcggccatcg acacattcgt ggccggtctg      1500
     ccgaagctgt ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page