(data stored in ACNUC30630 zone)

EMBL: AP009256.PE426

AP009256.PE426       Location/Qualifiers
FT   CDS_pept        536010..537137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0426"
FT                   /product="putative binding protein-dependent transporter"
FT                   /note="Orthologue of SAV4980"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39207"
FT                   /db_xref="GOA:A1A0H4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H4"
FT                   /protein_id="BAF39207.1"
FT                   /translation="MKAKGGWIDRFSSALLPIRETYLVVEKTMSSTSKDAVTLRAKRSK
FT                   KPSDGKMRRNVEIFVLSAPAILLFVCFVILPIVLGAYYGFYQWKGYGLPSKTGKFVGLQ
FT                   NYITALKDPAFQAAILHTFEVVIGSLVIQAPLAILFALLLNQKFKGRGLIRTLIFVPYV
FT                   VSEVIVGTGWSLLLQKKGAINEILANFGINGPDWLADPKIAIWTLLLLISWKYVGFAVI
FT                   LMLAGMQSIPEELYEAAKVDGASFWQMQKSITLPLLAPTLRIWVFLSMIGSLQLFDLVY
FT                   IVWGKYVSTTAGVSTMATYMVREGRGAGNYGYGSAVALIIFVISLIIALVYQKFVLNRD
FT                   LDGAVTEQKEAEKRARKRAKEVQHREVAALASEVK"
     ttgaaggcca aaggagggtg gatagacaga ttttcatctg ccctccttcc tattcgagaa        60
     acgtatctgg tagtggagaa aaccatgtca agtacaagca aagacgcggt gacgctgcgc       120
     gctaagcggt ccaagaaacc gtccgatggc aaaatgcgtc gtaatgttga gattttcgta       180
     ctgtccgcac ctgcgattct tctgttcgtc tgctttgtga ttctgcctat cgtcttgggt       240
     gcttattacg gcttctatca gtggaagggt tacggacttc cctccaagac aggtaaattc       300
     gttggtctcc agaactacat cacagcgctt aaggatcccg cgttccaggc ggcaattctg       360
     cataccttcg aggtcgtgat cggctcgttg gtcatccagg ctccgctcgc catcctgttc       420
     gcattgctgc tgaaccagaa gttcaagggg cgtggtctca tccgcaccct catcttcgtg       480
     ccgtatgtcg tttccgaggt catcgtcggc acaggatgga gcctgttgct gcagaagaag       540
     ggcgccatca atgagattct ggccaacttc ggcatcaatg gtcccgattg gctggccgac       600
     ccgaagatcg ctatttggac gctgctgttg ctgatcagct ggaaatacgt cggtttcgcc       660
     gtaattctga tgctcgccgg catgcaatcc attcccgagg aactgtatga agcagccaag       720
     gtggatgggg cgagtttctg gcagatgcag aaaagcatca cgttgccgtt gcttgctccg       780
     acgttgcgga tctgggtgtt cctttccatg attggctctc tgcagctttt cgatctggtc       840
     tatatcgtgt ggggcaagta tgtgtcgacc accgctggtg tgtccaccat ggccacctac       900
     atggtgcgtg aaggtcgtgg agccggcaac tatggctatg gttccgccgt tgctctgatc       960
     atcttcgtga tctctttgat catcgcactc gtctatcaga agttcgtgct gaaccgtgac      1020
     ttggacggtg ctgttactga acagaaagaa gccgagaagc gtgccaggaa gcgcgcaaaa      1080
     gaagtgcagc atcgtgaggt tgctgccctg gcaagtgagg tgaagtga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page