(data stored in ACNUC30630 zone)

EMBL: AP009256.PE429

AP009256.PE429       Location/Qualifiers
FT   CDS_pept        539792..541771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0429"
FT                   /product="putative secreted protein"
FT                   /note="Orthologue of XCV4334"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39210"
FT                   /db_xref="GOA:A1A0H7"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0H7"
FT                   /protein_id="BAF39210.1"
FT                   /translation="MKSMGNEERTSMVLRLPKLLDDGCVLQAGATIHIWGTGDPGRGVL
FT                   VRLDGKDRTTRVGDDGSWSVSYGPITAGGPYDLTVRYEDGTECISRQCYAGEVFLCSGQ
FT                   SNMELPMAWVRADYPLEWDREPDPLLRQYKAIPDCDFNGPRSDHDHAFWQGCDAETLGD
FT                   FSALAYFFGRRIRRWLNVPVGLLNVSLGGSPIESWMDADALRAFPEALADLEPYLGDGV
FT                   ASKKSRDSVAERDRWYQALGYEAVADAHHEWLPLIAWDCPESKNIEPRDVAWHDIRLPG
FT                   WYKDRGLAGFRGEITMRKTVFLPPSDAGKPALLRLGTMNDADHTWVNGVLVGGRSNVYE
FT                   PRDYPVAAGVLRAGANEIRMRLVVERPGGRVTPGKRMTLTIGDDIFDLSGIWQYAVTAE
FT                   ADRDCPFEDFVRWKPTGLYNAMLAPCFPYAVRAVLWYQGESNTGDRAMQYGDELKAMIQ
FT                   LWRVKWHQPDMPFLIVQLPKFDIDAIEDGGWPLIREQEWRVADELEHVAAVVTLDAGES
FT                   NDLHPHDKKTIADRAFNVAMDFVYGQQAQPQPVVETAEADDGLLRMHCVWRNSMGEQMQ
FT                   SQNRHLMTLDGDVPREIDFLWHDCATSVRAEAWLDGCDIVARIPSRMPDEVRYAWSNSP
FT                   ESGLICDGDGVLLPPFHLPLPMVD"
     ttgaaatcta tgggcaatga ggagcggacg agcatggtct tgcgattgcc gaaactgctt        60
     gacgacggtt gcgtgctgca ggccggtgcg accatacata tctggggcac cggcgaccct       120
     ggacgcggcg tgctggtacg cctcgatggc aaggaccgga ctacacgggt gggggacgac       180
     ggctcatgga gcgtgtcgta cggtccgatc acagcaggcg gaccgtacga tttgacggtg       240
     cgttatgagg acggaaccga atgcatctcg cgccaatgct atgcgggaga agtgttcctg       300
     tgttcgggac agtcgaacat ggaactgccc atggcttggg tgcgtgcgga ctatccgttg       360
     gagtgggatc gtgagcctga cccattgctg cggcaataca aagcgattcc cgattgcgac       420
     ttcaacggtc cccgcagcga tcatgaccat gcattctggc aggggtgcga tgcggaaacc       480
     cttggggatt tctccgcgct cgcctatttc ttcggacgca ggatccgtcg gtggctgaat       540
     gtgcccgtcg gcctgttgaa cgtttcattg ggcggatcgc cgattgaatc ctggatggat       600
     gccgacgcat tgcgggcgtt ccccgaagcg ctcgctgacc ttgagccgta tcttggcgat       660
     ggcgtggcgt cgaagaaaag ccgcgattcc gttgccgaac gggaccggtg gtatcaggcg       720
     cttggatacg aggctgtggc cgatgcccac catgaatggc tgccattgat cgcgtgggac       780
     tgtccggaat ccaagaacat cgagccgcgc gacgtggcat ggcatgacat acgcctgcct       840
     ggatggtaca aggatcgcgg acttgccggt ttccgcggcg agattaccat gagaaaaacc       900
     gtgttcctgc ctccgtcgga tgcggggaag cccgccctac tgcgtctggg caccatgaat       960
     gatgccgacc atacgtgggt caatggtgtg ttggtcggtg ggcgaagcaa tgtgtatgag      1020
     ccgcgggact atccggtcgc agccggcgtg ttgcgcgccg gcgcgaacga aatccgcatg      1080
     cgtctggtcg ttgaacggcc cggcggccgt gtgacgcccg gcaaacggat gacactgacc      1140
     atcggagacg atatcttcga cctgtccggc atttggcagt atgccgtgac cgccgaagct      1200
     gaccgcgatt gcccattcga ggatttcgtc agatggaagc cgaccggcct gtacaacgcc      1260
     atgctcgccc cgtgttttcc atatgcggtg cgggccgtgc tgtggtatca gggcgaatcg      1320
     aataccggcg atcgcgccat gcaatatggt gacgagctga aggccatgat tcaattgtgg      1380
     cgcgtcaaat ggcatcagcc ggatatgccg tttctgatcg tccagcttcc aaaattcgac      1440
     atcgacgcca tcgaggatgg tggttggccg cttattcgag aacaggaatg gagagtggcg      1500
     gacgaacttg aacacgtggc tgcggtggtg acgcttgatg ccggtgaaag caatgatttg      1560
     catcctcatg ataagaaaac catcgcggat cgtgcattca atgtcgcgat ggattttgtg      1620
     tatggccagc aggctcagcc tcagccggtt gttgaaaccg cagaggcgga cgatggattg      1680
     ttgaggatgc actgcgtgtg gcggaattcc atgggcgaac agatgcaatc gcagaatcgc      1740
     catctgatga cgttggatgg tgacgttccg cgagaaattg atttcctgtg gcacgactgc      1800
     gccacttcgg tgcgggctga ggcatggctg gatggttgcg atattgtggc gcgcataccg      1860
     tcgcgcatgc cggacgaggt gcggtatgcg tggagcaaca gcccggaatc cggtctcatc      1920
     tgcgacgggg acggtgttct gcttccgccg tttcatctgc cgttgcccat ggttgattag      1980
//

If you have problems or comments...

PBIL Back to PBIL home page