(data stored in ACNUC30630 zone)

EMBL: AP009256.PE439

AP009256.PE439       Location/Qualifiers
FT   CDS_pept        complement(552313..552897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0439"
FT                   /product="cellobiose-phosphorylase"
FT                   /note="Orthologue of TM1848"
FT                   /note="Similar to GP:3184120 percent identity:
FT                   97.66;identified by sequence similarity"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39220"
FT                   /db_xref="GOA:A1A0I7"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0I7"
FT                   /protein_id="BAF39220.1"
FT                   /translation="MRYGHFDDAAKEYVIETPATPLPWINYLGNEDFFSLISNTGGGYS
FT                   FYKDAKLRRITRYRYNNVPADNGSRCYYLSLMDSDSADAKPVETWSPTFLPCKTPLDSC
FT                   KCRQGIGYTVFEASKRGIESKLTAFVPLHTNAEINRLDVTNTTDEPAVIDVTGSVEWCL
FT                   WNAVDDSSNFQRNLSTGEVEIGLATVCWTVS"
     atgcgctacg gtcatttcga tgatgccgca aaggaatacg tgattgaaac cccggcgact        60
     cccctgccgt ggatcaacta ccttggcaac gaggacttct tctcgctgat ttccaacacc       120
     ggcggcggct acagcttcta caaggacgcc aaactacgcc gcatcacccg ctaccggtat       180
     aacaacgtgc cggcagacaa cggctcccgc tgctattacc tgagcctgat ggactccgat       240
     tccgccgatg ccaagccggt cgaaacctgg tcgccgacct tccttccgtg caagaccccg       300
     cttgattcct gcaagtgccg tcaaggcatc ggctacaccg tgttcgaagc ttccaagcga       360
     ggcatcgaat ccaagctcac cgccttcgtg ccgctgcaca ccaatgcgga aatcaatcgg       420
     ctcgacgtga cgaacaccac cgacgagccg gccgtcatcg acgtgaccgg ctccgtggaa       480
     tggtgcctgt ggaatgccgt ggacgactcg tccaacttcc agcgcaacct gtccaccggc       540
     gaggtggaga ttggattggc gacggtgtgt tggacggttt cttag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page