(data stored in ACNUC30630 zone)

EMBL: AP009256.PE44

AP009256.PE44        Location/Qualifiers
FT   CDS_pept        complement(55633..56340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0044"
FT                   /product="hypothetical protein"
FT                   /note="COG family: FHA-domain-containing proteins"
FT                   /note="Orthologue of BL0583"
FT                   /note="PFAM_ID: FHA"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38825"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE2"
FT                   /protein_id="BAF38825.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLKPVDLSSALEREIDKEAM
FT                   PVTRDRTVAPNEYRFKLSTPDFNNIVEWGAETLANELADNLTQYAKSQNYAFVGPVVVI
FT                   FEEDLELSKGDYRLSRESVQGNTVPVTTDAQTEDCPMLEIGEHQYLLTEEKTIIGRGSD
FT                   CDIVIDDPGISRRHMEIDVTDNGNTVIARDLNSTNGMYVEGHHVEAATLLDGNTITIGR
FT                   TRILYWASSQEQE"
     atgagtgttc tcgaccgatt tgagaagagc gtggaaggcg ccgtcaacgg ggttttcgcg        60
     aagttcgggt ctaaagacct gaagcccgtc gacctttcca gcgctctgga acgcgagatc       120
     gacaaagaag ccatgcccgt cacgcgcgat cgcaccgtag ccccgaacga gtaccgtttc       180
     aagctcagca ctccggattt caacaacatc gtcgagtggg gcgccgaaac gctcgccaat       240
     gaacttgccg acaacctcac ccagtatgcg aagagccaga actacgcgtt cgtcggcccg       300
     gtcgtggtga tcttcgaaga ggatcttgaa ctttccaagg gcgattaccg gctttccaga       360
     gaatccgtgc agggcaacac cgtgccggtc acgacngacg cgcagaccga ggattgcccg       420
     atgttggaga tcggcgagca ccagtatctg ctcaccgagg aaaagaccat catcggccgt       480
     ggttccgatt gcgacatcgt catcgacgac cccggcatct cccgtcgtca catggagatc       540
     gacgtcaccg acaacggcaa caccgtcatc gcccgcgacc tgaactccac caacggcatg       600
     tacgtcgaag gccatcatgt tgaggcggca acgctgctcg acggcaacac gatcaccatc       660
     ggccgaaccc gcatcctgta ctgggcctcc tcgcaggagc aggagtaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page