(data stored in ACNUC30630 zone)

EMBL: AP009256.PE455

AP009256.PE455       Location/Qualifiers
FT   CDS_pept        569773..571185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0455"
FT                   /product="possible helicase"
FT                   /note="COG family: ATP-dependent exoDNase (exonuclease
FT                   V)_alpha subunit - helicase superfamily I member"
FT                   /note="Orthologue of BL1724"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39236"
FT                   /db_xref="GOA:A1A0K3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K3"
FT                   /protein_id="BAF39236.1"
FT                   /translation="MRQSEALAILGSGASVFLTGAPGAGKTYVLNEFIRQARADGASVA
FT                   VTASTGIAATHINGTTIHSWSGIGLATALTDNLVKTVRTRRKRKLQEADILIIDEVSML
FT                   HAWLFDMVDRICRIIRRDERPFGGLQVVLSGDFFQLPPVSVSGRNNDLIAPSAEYLASR
FT                   ERYMRAGLNPEGFVTESLVWRELNPVVCYLTEQHRQDDGQLLNVLTDIREGAVDDGDRN
FT                   VLLTRLGAIPEPGQQAVNLFPVNRQADALNDLRLFEIKEEPHEYLAESEGAANLVERLK
FT                   KNMLAPERLYLKTGAAVMAVRNDTDHQYVNGSLGTVRGFTTQSQGGWPIVEFENGNIVT
FT                   MKPNSWQMQDGDTVLATVKQVPLRCAWAITIHKSQGMTLDRAVMDLRRTFAPGMGYVAL
FT                   SRVEGLDGLYLQGVNERMFLVSPDAVRLDGQLRLESAQAVDTLASDGVGAFRARMPQPA
FT                   GEDDEFAQDVLF"
     atgaggcaat ccgaggcgct tgcgattctg ggttccggcg caagcgtgtt cctgacgggc        60
     gcgcccggtg ccggcaaaac ctacgtgctc aacgaattca tacggcaggc gcgtgccgac       120
     ggcgcatccg tggccgtcac cgcatccacg ggcatcgctg ccacgcatat caacggcacc       180
     accatccatt cctggagcgg catcggcttg gccacggcat tgaccgacaa tctggtcaaa       240
     accgttcgca cacgccgcaa acgcaagctg caggaagccg acatcctcat catcgacgag       300
     gtctccatgc tgcacgcgtg gctgttcgac atggttgacc ggatctgccg catcatccgc       360
     cgcgacgaac gtccgttcgg cgggctgcag gtggtgttgt ccggcgattt tttccagctg       420
     ccgccggttt cggtatcggg acgcaacaac gacctgatcg cgccgtccgc cgaatatctg       480
     gccagtcgcg aacggtacat gcgcgccgga ctcaatcccg aaggtttcgt caccgaatcg       540
     ttggtatggc gcgaattgaa ccccgttgtc tgctatctga ccgaacagca tcgtcaggat       600
     gacggccagc tgttgaacgt gctgaccgac attcgcgaag gcgcggtgga cgatggcgac       660
     cgcaatgtgc tgctgacccg gttgggggcc attccggaac ccgggcagca ggcggtgaac       720
     ctgttccccg tcaacaggca ggccgacgcg cttaatgacc tgcgcctgtt cgaaatcaag       780
     gaggagccgc acgaatacct cgccgaatcc gagggcgcgg cgaatctggt ggaacggctc       840
     aaaaagaaca tgctcgctcc cgaacgcttg tacctcaaaa cgggcgcggc cgtgatggcg       900
     gtgcgcaacg acaccgacca ccagtacgtc aacgggtcgc tcggcaccgt gcgtggattc       960
     accacgcaat cgcagggcgg ctggccgatc gtcgaattcg aaaacggcaa catcgtcacc      1020
     atgaagccga attcctggca gatgcaggac ggcgataccg tgctcgccac ggtcaaacag      1080
     gtgccgttgc gctgcgcgtg ggcgatcacc atccacaaat cgcaaggcat gacgctcgat      1140
     cgtgccgtca tggatttgcg gcgcacattc gcgccgggca tgggatacgt ggcgctgtcg      1200
     cgagtggaag ggctcgacgg cctgtatctg caaggcgtca acgagcgcat gttcctggtc      1260
     tcaccggacg cggtccgtct tgatggacaa ttgcgattgg agtcggcgca ggccgtcgat      1320
     acgcttgcct ccgacggtgt cggagcattc cgcgcccgca tgccgcaacc ggccggtgag      1380
     gatgacgaat tcgcgcagga cgtgctgttc tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page