(data stored in ACNUC30630 zone)

EMBL: AP009256.PE46

AP009256.PE46        Location/Qualifiers
FT   CDS_pept        complement(59226..60515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0046"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of CE2341"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38827"
FT                   /db_xref="GOA:A0ZZE4"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZE4"
FT                   /protein_id="BAF38827.1"
FT                   /translation="MHAEPTKPRPVSAFRSWHNHMRADHPKLWHPIRITIVVITVWWIL
FT                   FCLVLAPTDNPAAIVWTIIEIAVLLLSPFFPKSMSLLFLIMSQSGPWLIPGADVNSLPG
FT                   ILYTFGMLAYETNNLVALLLLAYSIGDQLFRQLVLGTSRSNPVAIIAMVSLVLMLGCGL
FT                   RWNQAVAGSRAEAEQAKARLREMESRSHIAEAIHDAVTGDLSAAAFVAQRRIDALSGGG
FT                   DGDGSASTDGDDGKNADERRDELDKWTQVNDYILSALTNVHRVIDELDMDVTVLEEDAD
FT                   GKAFSDLLKATMAGGDRRLRALGFDITSILHVAGGAPSASPSLAGIANDLLRETYANIA
FT                   RHAQSGSKADLSVILKPNAVEITQINQARTTETDRTQPGGHGLAYFSKQLESHGGKLET
FT                   TLRDGEWTLFAYLPIPVPETLPPLAGHPES"
     atgcacgctg aacccacaaa acccagaccc gtaagcgcct tccgctcctg gcacaaccat        60
     atgcgtgccg accatccgaa actctggcat ccgatccgca taaccatcgt ggtcatcacc       120
     gtatggtgga tcctgttctg cctggtgctc gccccgaccg acaatcccgc ggcgatcgtc       180
     tggaccatca tcgaaatcgc ggtgctgctg ctgtcaccgt tctttccgaa atcgatgtcg       240
     ctgctgtttc tgatcatgag ccagtcggga ccttggctca tacccggagc cgacgtcaac       300
     tcgctgccgg gaatccttta cacgttcggc atgctcgcct acgaaaccaa caatctcgtg       360
     gcgctgctgc tgctcgctta ttccataggc gaccagctgt tccgtcaact ggtccttggc       420
     acgagccgca gcaatcccgt ggccatcatc gccatggtca gcctggtact gatgctcgga       480
     tgcggtttgc gatggaacca ggccgtagcc ggcagccgcg ccgaggcgga gcaggcgaaa       540
     gcgcgattac gggagatgga aagccgcagt cacatcgcgg aagccataca cgacgccgtg       600
     acgggagatc tgtccgccgc ggctttcgtc gcgcaacgtc gcatcgatgc attgtccggc       660
     ggaggcgatg gcgatggcag cgcctcgacg gatggtgacg acggcaagaa cgcggacgaa       720
     agacgcgatg agctcgacaa atggacgcag gtcaacgatt acatcctgtc cgccctgacc       780
     aacgtgcatc gcgtcatcga cgaactggat atggacgtca ccgtccttga ggaggatgcg       840
     gacggcaagg ccttctccga cctgctcaaa gccacgatgg ccggcggcga ccggcgtcta       900
     cgcgcgctcg gcttcgacat cacctcgatc ctccatgtgg cgggcggtgc gccaagcgcc       960
     tccccgagcc tggccggaat cgccaatgat ctgcttcgcg agacctacgc caacatcgcg      1020
     cgtcacgccc agtccggcag caaagccgac ctgtcggtga tactcaagcc gaacgccgtc      1080
     gaaatcacgc agatcaacca ggcgaggacc accgaaacgg atcgcacgca gccgggaggc      1140
     cacggcctcg cgtatttcag caaacagctc gaatcgcatg gcggcaaact cgagacaacg      1200
     ctgcgcgacg gcgaatggac gctgttcgcc tatctgccga ttccggtgcc cgaaaccctg      1260
     ccaccccttg ccggacaccc cgaatcgtga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page