(data stored in ACNUC30630 zone)

EMBL: AP009256.PE461

AP009256.PE461       Location/Qualifiers
FT   CDS_pept        579167..580159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0461"
FT                   /product="hypothetical protein"
FT                   /note="COG family: tetrahydrodipicolinateN-
FT                   succinyltransferase"
FT                   /note="Orthologue of BL1734"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39242"
FT                   /db_xref="GOA:A1A0K9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR019875"
FT                   /db_xref="InterPro:IPR026586"
FT                   /db_xref="InterPro:IPR032784"
FT                   /db_xref="InterPro:IPR038361"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0K9"
FT                   /protein_id="BAF39242.1"
FT                   /translation="MTEQRTAWGWGLASIDAAGNTLDVWYPELTLGEAPAETSRPNHNF
FT                   GAIAHDEADARGVRRMPVFTVSKLDEPIEDAADAYLRLHLLSMRLAKPNTLNLDGIFAK
FT                   LNNVVWTNYGPFAVDDFALRKLDVMAATRQSGAVLAPHVDVNVLSIDKFPRMVDYVVPT
FT                   GVRIGDADRVRLGAHLSEGTTVMHAGFVNFNAGTLGVSMVEGRVSQGVVVGNGSDIGGG
FT                   ASIMGTLSGGGKLKNSIGEHSLLGANAGIGISLGDNCVVEAGLYVTAGTKVTIYDKAKV
FT                   AAGEPLETVKGAELSGKDNILFIRNSVSGRIEARYRKTGIELNEKLHKN"
     atgactgaac agcgcaccgc atggggttgg ggtctggcaa gcatcgatgc ggccggcaac        60
     acccttgacg tgtggtatcc ggaactcacg ttgggcgagg ctccggctga aacctcgcgt       120
     ccgaatcaca acttcggcgc catcgcgcat gacgaggccg acgcgcgtgg cgtgcgccgc       180
     atgcccgtgt tcaccgtgtc caagctggac gagccgatcg aggacgccgc cgacgcctat       240
     ctgcgtctgc acctgctgag catgcgtctg gccaagccga acacgttgaa tctcgacggc       300
     attttcgcca agctcaacaa cgtggtgtgg accaactacg gtccgttcgc cgtcgatgat       360
     ttcgctttgc gcaagcttga cgtgatggcc gccacccgac agtccggagc cgtgttggcg       420
     ccgcacgtcg atgtgaacgt gctgtcgatt gacaagttcc cccgcatggt cgactacgtc       480
     gtgccgaccg gcgtgcgcat cggcgacgcc gaccgcgtgc gactgggcgc gcacctgtcc       540
     gaaggcacca ccgtcatgca cgccggcttc gtgaacttca atgcgggcac cctcggcgtc       600
     tccatggtcg aaggccgcgt ctcgcaaggc gtcgtggtcg gcaacggctc cgacatcggc       660
     ggcggcgcgt ccatcatggg caccctgtcc ggcggcggca agctcaagaa ctccatcggc       720
     gagcactccc tgctcggcgc gaacgccggc atcggcatct ccctgggaga caactgcgtg       780
     gtcgaagcgg gcctgtacgt caccgccggc accaaggtca ccatctacga caaggccaag       840
     gtcgccgccg gcgaaccgct cgaaaccgtc aagggcgccg aactgtccgg caaggacaac       900
     atcctgttca tccgcaactc cgtgtccggc cgcatcgagg cgcgctaccg caagaccggc       960
     atcgagctca acgagaaact ccacaagaac tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page