(data stored in ACNUC30630 zone)

EMBL: AP009256.PE470

AP009256.PE470       Location/Qualifiers
FT   CDS_pept        588667..589734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0470"
FT                   /product="probable solute binding protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type amino acid transport
FT                   system_periplasmic component"
FT                   /note="Orthologue of BL1179_BL1178"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39251"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0L8"
FT                   /protein_id="BAF39251.1"
FT                   /translation="MPLRFLPINVGVALRFYRVPLEYWTSDWQMDDYRSVDGKRIEGEP
FT                   TMSLKFKSFAALALSAAMMFSVAACGTTDSGDAKSDSKAKNTTVGYDVSTIKKDDELAK
FT                   LAASAKTVKDGELSVGMELSYAPAEFYAEDGKTPVGYDVDMSKAIAQTLGLKPKIVSSM
FT                   FDTIVPSIGSKYDLGITAMTITEERLQSVDFVSYYRAGSTWAVQKGNPKKLDTSDMCGA
FT                   KIAVQTGTVQEDEANKIAKGCKADKKAEVMSYKRQAEAATAVATGKADVFYADSPVAGY
FT                   AISQTDGQLEALGDVEGVAKQGIAIKKGDQQLDEAVQKAVQKLMDDGTYMKILKHWGVE
FT                   SGALDKAEINPTDLN"
     atgcccctac gctttttgcc gattaacgtc ggcgtagcat tgcggtttta tcgtgtgcct        60
     ttggaatact ggacgtctga ttggcaaatg gacgattacc gttcagtgga tgggaagaga       120
     atagaaggag aacccactat gtcgttgaaa ttcaaatcgt ttgccgctct cgcgctgagc       180
     gcggccatga tgttctccgt cgccgcatgc ggcaccacgg attccggtga cgccaaaagc       240
     gactcgaagg cgaagaacac caccgttggt tacgatgtga gcaccatcaa gaaggatgac       300
     gagctggcca agctggccgc ctccgcgaag accgtcaagg acggcgagct gtccgtcggc       360
     atggaactgt cctatgctcc ggccgaattc tacgccgaag acggcaagac gccggtcggc       420
     tacgatgtgg acatgtccaa ggccatcgcc cagacgctgg gcctgaagcc gaagatcgtc       480
     tcctccatgt tcgacaccat cgtcccgtcc atcggctcca agtacgatct gggcatcacc       540
     gccatgacca tcaccgaaga gcgtctgcag tccgtcgact tcgtgagcta ctaccgcgcc       600
     ggctccacgt gggccgtgca gaagggcaac ccgaagaagc tcgacacctc cgacatgtgc       660
     ggcgcgaaga tcgcagtgca gaccggcacc gtccaggagg acgaggccaa caagatcgcc       720
     aagggctgca aggccgacaa gaaggccgaa gtgatgtcct acaagcgtca ggccgaagcc       780
     gccaccgcag tggccaccgg taaggccgac gtgttctacg ccgattcgcc ggtcgccggc       840
     tacgcgatct cccagaccga cggccagctt gaggccctcg gcgacgttga aggcgtggcc       900
     aagcagggca tcgccatcaa gaagggcgac cagcagctcg acgaggccgt gcagaaggcc       960
     gtgcagaagc tgatggatga cggcacgtac atgaagatcc tcaagcattg gggcgtcgag      1020
     tccggcgctc tcgacaaggc tgagatcaat ccgaccgacc tcaactga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page