(data stored in ACNUC30630 zone)

EMBL: AP009256.PE477

AP009256.PE477       Location/Qualifiers
FT   CDS_pept        complement(597563..598333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0477"
FT                   /product="hypothetical protein"
FT                   /note="COG family: putative transcriptional
FT                   regulators_homologs of bvg accessory factor"
FT                   /note="Orthologue of BL1162"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39258"
FT                   /db_xref="GOA:A1A0M5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0M5"
FT                   /protein_id="BAF39258.1"
FT                   /translation="MLLMAVDIGNTNVVIGFIDDGRIAGTYRITTKANHTSDEYGLMIT
FT                   QFLALSGYKPADVDDVIISSVVPKVMHSFRASIVKFLDIDPMIVGPGIKTGLNIRMDNP
FT                   QNMGADCIADCAGAYYEYGGPILVADFGTATTFNYVTADASVISGLITTGIRTAAAALW
FT                   EGTAQLPEVEITRPKSILAKSTKPAMQAGLYYNFLGGIERTIAQFHKEIDEDFRVVATG
FT                   GLSRVFADGTNMIDIYDPDLIFKGMWHIYDRNVR"
     atgcttctga tggctgtgga tatcggcaac acgaacgtcg tgatcggttt catcgacgat        60
     gggcgcatcg cgggcacgta ccgcatcacc acgaaggcga accacacgtc cgacgaatac       120
     gggctgatga tcacgcagtt cctggctttg agcggctaca agccggcgga tgtcgatgat       180
     gtgatcattt cgtccgtggt gccgaaggtc atgcattcgt tccgtgcgag catcgtgaag       240
     ttcctcgaca tcgatccgat gatcgtggga ccgggcatca aaacgggact caacatccgc       300
     atggacaatc cgcagaacat gggcgcggac tgcatcgccg actgcgcggg cgcgtattac       360
     gagtatggcg ggccgattct ggtggctgat ttcggcacgg ccaccacgtt caactacgtc       420
     accgcggacg cgtcggtgat ttccggactg atcaccaccg gtatccgcac cgccgcggcc       480
     gcactgtggg aagggacggc gcagctgccg gaagtggaga tcacccgtcc gaagtcgatt       540
     ctggcgaagt ccacgaaacc ggccatgcag gcgggcctgt actacaactt cctcggcggc       600
     atcgaacgca cgatcgcgca gttccataag gagatcgacg aggatttccg tgtggtggcg       660
     acgggaggat tgagccgcgt gttcgccgac ggcacgaaca tgatcgacat ttacgatccg       720
     gacctgattt tcaagggcat gtggcacatc tacgaccgca acgtccgctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page