(data stored in ACNUC30630 zone)

EMBL: AP009256.PE493

AP009256.PE493       Location/Qualifiers
FT   CDS_pept        616124..616609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0493"
FT                   /product="autoinducer-2 production protein LuxS"
FT                   /note="Catalyzes the hydrolyses of S-ribosylhomocysteineto
FT                   homocysteine and autoinducer-2"
FT                   /note="Orthologue of BL1152"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39274"
FT                   /db_xref="GOA:A1A0P1"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0P1"
FT                   /protein_id="BAF39274.1"
FT                   /translation="MAEDKPVVESFQLDHTKVKAPYVRYIDTETGLHGDVISNYDLRLV
FT                   QPNENAIPTGGLHTIEHTIAVLLRERIPGYIDCSPFGCRTGFHLLTWGEHSTEDVARAL
FT                   KESLEFIAYEATWDDVPATTIESCGNYRDHSLFTAKEWCKDILAKGISSDPFERRLV"
     atggcggaag acaagccggt ggtggaaagc ttccaattgg accacaccaa agtaaaggcg        60
     ccgtatgtgc gctacatcga tacggaaacc ggcctccacg gcgacgtgat ctcgaactac       120
     gacctgcgat tggtgcagcc gaacgagaac gccattccga ccggcgggct gcacaccatc       180
     gaacacacca tcgcggtgct gctgcgcgaa cgcatccccg gttacatcga ctgctcgccg       240
     ttcgggtgcc gcacaggctt ccacctgctg acgtggggcg agcattccac cgaggatgtg       300
     gctcgcgcat tgaaggaatc gttggaattc atcgcctacg aggccacatg ggacgacgtg       360
     ccggcaacca ccatcgaaag ttgcggcaac taccgcgacc acagcctgtt caccgccaag       420
     gaatggtgca aggacatcct cgccaagggc atcagctccg acccgttcga acgccgcctt       480
     gtgtga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page