(data stored in ACNUC30630 zone)

EMBL: AP009256.PE499

AP009256.PE499       Location/Qualifiers
FT   CDS_pept        624041..625234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0499"
FT                   /product="possible transport protein"
FT                   /note="COG family: di- and tricarboxylate transporters"
FT                   /note="Orthologue of BL1140"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39280"
FT                   /db_xref="GOA:A1A0P7"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0P7"
FT                   /protein_id="BAF39280.1"
FT                   /translation="MRRLVVKVLKNETILVVASILALISCFIVPPDKEYAGYIHASTIS
FT                   QLICLMLVVCGFQRIGVFRIIGSRLLHHVKTARGLVLTLIALPFFSGMLITNDVALVTF
FT                   VPFAIAVLTMAHMEEHAVLVGTLMTIGANVGSMLTPIGNAHNLYLKALTGMPTSEMIGI
FT                   MAPYSATAAVLLIIITCVIFGSKPVSEFSAIDSSGIEQNVLAPHSDRPQPDEIRVTGYG
FT                   AGYGGWRTIVYSVLFVVCLLAVSDFIPLWLMCVIVFVAFLLCDRRVFRNVDWGLPLTFC
FT                   MFFIFIGNMKRVPEFYELAASLVGAHPLEVAVVSSQFISNVPTTLLLSGFCDQWRELII
FT                   GTNLGGLGTLIASMASLIGYKNVTRAYPDKKGRYLAVYTAVNVLFVIVLVGLSWIIE"
     atgcggcgat tggtcgtcaa ggtcctgaag aacgagacca ttctcgtagt cgcttccata        60
     ctcgcactca tatcgtgctt catcgtgccg ccagacaagg aatacgccgg ctacatccac       120
     gccagcacca tctcgcagct gatctgtctg atgcttgtgg tgtgcggctt ccagcgcatc       180
     ggcgtgttcc gcatcatcgg ctcgcgcctg ctgcatcacg tcaaaaccgc gcgtggcctg       240
     gtgctcacgt tgatcgcatt gccgtttttc tccggcatgc tcatcaccaa tgatgtggcg       300
     ttggtcacct tcgtgccgtt cgcaatcgcg gtgttgacga tggcgcacat ggaagagcat       360
     gcggtgcttg tcggcacgct gatgaccatc ggcgcgaacg tgggcagcat gctcaccccg       420
     atcggcaacg cgcacaacct gtatctgaaa gcgttgacgg gcatgccgac gtccgagatg       480
     atcggcatca tggccccgta ttccgctacc gcagccgttc tgctgataat catcacctgc       540
     gtgattttcg gcagcaaacc ggtttccgaa ttttccgcga tcgatagttc cggcatcgaa       600
     cagaacgtac tcgccccgca ttccgaccgg ccgcagcctg acgagattcg cgtgaccggc       660
     tacggtgccg gttatggcgg ctggcgtacg attgtgtatt cggtgctgtt cgtggtctgc       720
     ttgctggcgg tgagcgattt cattccgctg tggttgatgt gcgtcatcgt gttcgtggcg       780
     ttcctgctat gcgaccgccg cgtgttccgc aacgtcgatt ggggactgcc gctcacgttc       840
     tgcatgttct tcatcttcat cggcaacatg aaacgcgtgc cggaattcta cgagctggcc       900
     gcctcgctgg tgggcgcgca tccgctggaa gtggccgtgg tgtccagcca gttcatctcc       960
     aacgtgccga ccacgctgct gctgtccggc ttctgcgacc agtggcgtga actgatcatc      1020
     ggcaccaacc tgggcggctt gggcacgctg atcgcgtcca tggcgtcgct gatcggctac      1080
     aagaacgtga cgcgcgccta cccggacaag aaaggccgtt atctggccgt ctacaccgcg      1140
     gtgaacgtgc tgttcgtcat cgtgctcgtc ggcctgagct ggattatcga gtag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page