(data stored in ACNUC30630 zone)

EMBL: AP009256.PE529

AP009256.PE529       Location/Qualifiers
FT   CDS_pept        complement(664397..664612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0529"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BPSL0772_BL1101"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39310"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0S7"
FT                   /protein_id="BAF39310.1"
FT                   /translation="MQSSSGISQPARLLHKACRWHTRITSIQVCRTMLDNRVATATAVI
FT                   RRVAPTPSWHRSHSPTRHLARIASNL"
     atgcaatcga gttccgggat atcccaaccc gcacgcctgt tacataaggc atgccgttgg        60
     cacacacgaa ttaccagtat acaggtctgc cggacaatgc tggataatcg tgtcgcgaca       120
     gcaacggccg ttatacgaag agtggctccg acgccatcct ggcatcggag ccactctccc       180
     acgcgccacc ttgcgcgcat cgcttcaaac ctctga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page