(data stored in ACNUC30630 zone)

EMBL: AP009256.PE538

AP009256.PE538       Location/Qualifiers
FT   CDS_pept        676023..676610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0538"
FT                   /product="guanylate kinase"
FT                   /note="COG family: guanylate kinase"
FT                   /note="Gmp kinase"
FT                   /note="Orthologue of BL0070"
FT                   /note="PFAM_ID:Guanylate_kin"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39319"
FT                   /db_xref="GOA:A1A0T6"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0T6"
FT                   /protein_id="BAF39319.1"
FT                   /translation="MADSQHGRLIVLCGPAGVGKGTVLGRVREQHPEIWLSVSATTRQP
FT                   RPGEVNGVNYFFMTEPEFLAKEKAGEFLETADVFGLAHYGTPVKPVVEHLERNIPVVLE
FT                   IDLQGARTVKRRAKELGLEVLTVFIEPPSFEELKRRLIGRGTETPQQQAKRLETAKVEL
FT                   AAAPEFDKRIVNNVVDEAADELWHIIAEEFGL"
     atggctgatt ctcaacatgg acgtttgatt gtgctctgcg gacccgccgg agtgggcaaa        60
     ggcactgttc tggggcgcgt acgcgaacag caccccgaaa tctggctgtc ggtgtccgcc       120
     acgacacgcc agcctcgtcc gggcgaagtg aacggcgtga actatttctt catgaccgaa       180
     cctgaattcc tggccaaaga aaaggcgggg gagtttctcg aaaccgccga cgtgttcggc       240
     ctcgcccact acggcacacc cgtgaaacca gtcgtggaac atctggaacg caatatcccc       300
     gtggtcttgg aaatcgacct acagggagcc cggacggtca aacggcgcgc gaaggaactc       360
     ggcctcgaag tgcttaccgt gttcattgag ccgccgtcct tcgaagaact gaaacgtcgt       420
     ctgatcggcc gtggcaccga aacccctcag cagcaggcca aaaggcttga gaccgccaag       480
     gtcgagttgg ccgctgcgcc ggaattcgac aaacgcatcg tcaataacgt ggtcgacgag       540
     gccgcagacg agctttggca tatcatcgcc gaagagttcg gcctgtaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page