(data stored in ACNUC30630 zone)

EMBL: AP009256.PE571

AP009256.PE571       Location/Qualifiers
FT   CDS_pept        712480..713877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0571"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BL0008"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39352"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0W9"
FT                   /protein_id="BAF39352.1"
FT                   /translation="MSDTTMDPKAIAQAVAVTVSDEDGQVGDFVEAIDLGDNVTDFRFE
FT                   SRVRGYEGWQWSVTLYHDVELDHWTVNESSLVPTDKALRPPKWIPWKDRLEPGDLAVTD
FT                   SIGTDPDDPRMEEGFRKTQDAETSDDTDDKPSVADETVQEPAMDGNASDESEKTDVSED
FT                   SEQPVTSEEDVEEAVEEFDLSRRHVLTPLGRSQTAKRWYEGPHGPKSLSTKTADGNPCS
FT                   TCGFFIPLKGELNLLFGVCANKWSPDDGRVVSIDHGCGEHSEIDPPEPSHLWVQSKPAF
FT                   DDMHIDIIAQAPRDERGSVELIEQLSSDDDHNPNEDEEGSDADIEANTIDDDASQEDVL
FT                   EHVASDDAPEVETTVTVVDENKPETSDDTESTDTAEPTESDEPVEQAEQVDSADSVNSA
FT                   ESFEPVEQMDETVVEPTAETTGQTENKSMEDESAEAESTEAESAAAETTESEMTEADSS
FT                   AQAESDE"
     atgtccgata ccacaatgga tcccaaggca atcgcccaag cggtcgctgt cacagtgtcc        60
     gacgaggacg gtcaggtcgg cgacttcgtg gaagccatcg acctgggaga caacgtcacc       120
     gatttccgct tcgaatcccg agtacgcggc tacgaaggct ggcaatggtc ggtcacgtta       180
     taccatgatg tcgaactgga ccattggacg gtcaacgaat catccctggt cccgaccgac       240
     aaggccctgc gtccgccaaa atggattcct tggaaggacc gtctcgagcc gggcgatttg       300
     gcggtgaccg attcaatcgg caccgatccc gatgaccccc gcatggaaga gggcttccgc       360
     aagacgcagg atgccgagac atcggacgat acggacgaca aaccgtcagt cgcggatgaa       420
     accgtacagg aaccggcgat ggatggaaac gcttcggatg agtctgagaa gacggacgtt       480
     tcggaggatt ccgaacagcc tgtgacgtcc gaagaggatg tcgaagaggc ggtcgaggaa       540
     ttcgacctgt cccgcaggca cgtgttgact ccgcttggcc ggtcgcagac cgcgaaacgt       600
     tggtacgaag gcccacatgg gccaaaatcg ctatccacca agacggccga cggcaatcct       660
     tgctccacgt gcggattctt cattccgctg aagggtgagt tgaacctgct gttcggcgtg       720
     tgcgccaaca agtggagccc ggatgacggc agggtcgtgt ccatcgatca tggctgcgga       780
     gagcattccg aaatcgatcc accggagccg tcgcatctgt gggtgcagtc gaagccggcg       840
     ttcgacgaca tgcatatcga tatcatcgcc caggcgccgc gtgacgagcg gggctccgtg       900
     gagctgatcg aacagctttc gtccgatgac gaccataatc cgaatgagga tgaggaaggt       960
     tcggacgcgg acatcgaagc caacaccatc gacgacgacg ccagccaaga ggatgtgctt      1020
     gagcatgtgg cttccgacga tgcgcctgaa gtagagacca ccgtcaccgt ggtcgacgag      1080
     aataagccgg aaacgtcgga cgataccgaa tcgactgata cggctgagcc gactgaatcg      1140
     gacgagccag tcgaacaggc tgaacaggtt gattccgccg attccgtcaa ttccgccgag      1200
     tcgttcgagc cggttgaaca gatggatgag acggtagttg agccgactgc tgaaaccacc      1260
     gggcaaacgg aaaacaaatc gatggaagac gaatcggcgg aagctgagtc aacagaagcc      1320
     gaatcggcgg cggctgaaac aacggaaagc gaaatgacgg aagctgattc gtcggcccaa      1380
     gccgaatccg acgaataa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page