(data stored in ACNUC30630 zone)

EMBL: AP009256.PE592

AP009256.PE592       Location/Qualifiers
FT   CDS_pept        complement(740972..741889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0592"
FT                   /product="probable iron sulfur protein associated with
FT                   succinate dehydrogenase"
FT                   /note="COG family: succinate
FT                   dehydrogenase_fumaratereductase Fe-S protein"
FT                   /note="Orthologue of BL0939"
FT                   /note="fumarate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39373"
FT                   /db_xref="GOA:A1A0Z0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0Z0"
FT                   /protein_id="BAF39373.1"
FT                   /translation="MSGMENGMETVTLRVNRFTPRPERGRERGGSPFARKSSPFGDSGS
FT                   ARRRPRGKQWVQDYVVPARPEDTVLDCLLKVKRTIDPTLAFRYSCGHGMCGSDAVSING
FT                   TPTLLCTATVKAWAKQPSDAQVDEDGFRHTGEDVQPAQTQDADDLGVIELAPLPGFPVQ
FT                   RDLIADIDQMLGQIRKLKPYLQASGELATTADGKINAFEYLQNPQQLSKYELLSNCIAC
FT                   GTCEGSCPVYAGGEAFIGPAALIAASRFINDSRDGQTDARMDAIDSADGIAACQSVRAC
FT                   TRECPRGIDVGEEIWQLIAQIKER"
     atgagcggca tggagaacgg catggaaacg gtgacgttgc gggtgaacag gttcacgccg        60
     cgtcccgaac gcggccgtga acgaggcggc tcgccgttcg ctaggaagag ctctcccttc       120
     ggcgattccg gatccgcgcg caggcgtccg cgaggcaagc agtgggtgca ggattacgtg       180
     gtgccggcgc gtccggagga caccgtgctt gactgcctgc tcaaagtcaa gcgcaccatc       240
     gatccgacgc ttgccttccg ttattcgtgc ggtcatggca tgtgcggttc cgatgccgtg       300
     tccatcaacg gcacgcctac gcttctgtgc accgccacgg tgaaggcttg ggcaaagcag       360
     ccatccgacg cacaggtgga tgaggacggc ttccgtcata cgggagaaga cgttcaaccc       420
     gcgcaaacgc aggatgccga cgatttgggt gtcatcgagc tcgcaccgct gcccggtttc       480
     cccgtgcagc gtgatttgat cgccgatatc gaccagatgc ttggccaaat caggaagctc       540
     aagccgtatc tgcaggccag tggcgaactc gccaccaccg cggacggcaa gatcaacgca       600
     ttcgaatatc tgcagaatcc ccagcagctc tccaagtatg agctgctgag caactgcata       660
     gcctgcggca cctgtgaggg aagctgtccg gtatatgcag gcggcgaggc gttcatcggc       720
     cctgcggctc ttatcgccgc ctcccgtttc atcaatgatt cacgcgacgg tcagacggat       780
     gcacgtatgg atgccatcga ttccgccgat ggcatcgccg cgtgccagtc ggtgcgcgcc       840
     tgcacgcgtg aatgcccgcg tggcatcgat gtcggtgagg agatctggca gctgatcgcc       900
     caaatcaagg agcgctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page