(data stored in ACNUC30630 zone)

EMBL: AP009256.PE60

AP009256.PE60        Location/Qualifiers
FT   CDS_pept        76153..77937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0060"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of sll0641"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38841"
FT                   /db_xref="GOA:A0ZZF8"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF8"
FT                   /protein_id="BAF38841.1"
FT                   /translation="MGCLRGASQCRTVVACALLCLWLTDGGYSTRGARRMGLSMNTVAD
FT                   CLQRHYRVVVFAVYLAVVIVTMAFHEPWFDEAQSWLIARDCPYRDLLLVRPHYEGHPPL
FT                   WWLLLSIPAKLGVPYEWGLKGVELVCSALMCGLLVFRAPLPRLAVALLPFTYFLCYQYG
FT                   VTSRPYALMCCALFVIAACWKSRDEHPWRLTAAFVLLCCTSSYGIALACAFALVWMVRA
FT                   IRGATGRPAVRDGLFGNPARFAAWMVLLAVGLVLTACVLPRSDTFGAVQDPGGNPPIAQ
FT                   FALFWTVLPAESMFTAFAGDVSLHGLHMGVLAIALCVALSLAIWSVLARVALRRKNLDL
FT                   LLVTYVLLSLCATKYFSMHHIGIIFALFVVQLWINVQDKALGIADIPLPTPLSRSLRAA
FT                   CATHAVRVAHIARIAIVVALLPSLVWTAAAIACDIRYDYSAGRALATFVRNNNLEHNRW
FT                   VSFWRYLPDTTWPDGTHTNRMEDTYRYSWPAIAANPYFARNLLDCTYEGRTFVPNQVPS
FT                   RAQMNREIASCAAKGAPEFLIGDTDFPQYFFHRLGLKRGDYRQIVVASQHVPWKTWVTS
FT                   SDIAVYVRSDVYRTLPHA"
     gtgggatgtt tgagaggcgc atcacagtgc cgtaccgtgg tcgcatgtgc gttattatgc        60
     ttatggctta ctgatggggg atattcaacg cgtggggcgc ggaggatggg gttatctatg       120
     aatacggttg ctgactgcct gcaacggcat taccgtgtgg tggtgttcgc cgtgtatctt       180
     gcggtggtca tcgtcacgat ggcgttccac gagccgtggt tcgacgaggc gcaatcgtgg       240
     cttattgcaa gggattgccc ttatcgagac ctgctgctcg tccgcccgca ttacgaaggc       300
     catccgccgc tgtggtggct gttgctgtcg attccggcga agctgggcgt gccatatgaa       360
     tgggggttga aaggggttga gctggtctgt tcggcattaa tgtgcggatt gttggttttc       420
     cgcgcgccac tgccccggct ggccgttgcg ctgctgccgt tcacctactt tctgtgctac       480
     caatacggcg tcacctcgcg gccctacgcg ttgatgtgct gcgcgttgtt cgtcatcgcg       540
     gcctgctgga aatcgcgcga tgaacaccca tggcgattga cggccgcgtt cgtgctgctg       600
     tgctgcacca gcagttacgg cattgcgctg gcatgcgcgt tcgcattggt ttggatggtg       660
     cgtgcgattc ggggcgcaac aggccgtcct gccgtacgtg acgggctttt cggcaatccc       720
     gcccggttcg cggcttggat ggtattgctg gccgtcggtc ttgtattgac ggcgtgcgtc       780
     ctgccgcgct ccgacacgtt cggcgcggtg caggatcccg gcggtaatcc gccgatcgcg       840
     caattcgcgc tgttctggac ggtgctgccc gccgaaagca tgttcaccgc ttttgcgggc       900
     gatgtttccc tgcatggtct gcacatgggc gttcttgcga ttgcgttgtg cgtggcgctg       960
     tcactggcga tttggagcgt gctggcacgg gtcgcgttgc gccgcaagaa cctcgatctg      1020
     ctgttggtca cgtatgttct gctgagcctg tgcgcgacga aatacttcag catgcaccac      1080
     atcggcatca tcttcgcgct gttcgtcgtg caactgtgga tcaacgtgca agacaaggcc      1140
     ctcggaatcg ccgatattcc actgccgacg cctctttcgc gttcgctgcg cgccgcctgt      1200
     gccacgcacg ccgtccgcgt cgcgcacatc gcccgtatcg caatcgtcgt ggcgctgctg      1260
     ccaagtctgg tgtggaccgc cgccgcgatc gcatgcgaca ttcgctacga ctattcagcc      1320
     ggtcgcgcgc tggccacgtt cgtgcgcaac aacaacctcg aacacaaccg ttgggtgtcg      1380
     ttctggcggt atcttcccga cacgacctgg cccgacggca cgcacacgaa tcgcatggaa      1440
     gacacgtacc gctacagctg gccggcgatc gcggcaaatc cgtacttcgc gcgcaatctg      1500
     ctggactgca cgtacgaggg ccgcacgttc gtgccgaacc aggtgccgtc gcgggcgcag      1560
     atgaaccgcg aaatcgcaag ctgtgccgcc aaaggcgcac cggaattcct tatcggtgac      1620
     accgattttc cgcaatattt cttccatcgg ctcggattga agaggggcga ttaccggcaa      1680
     atcgtcgtcg ccagccagca cgtgccgtgg aaaacatggg tcacgtcttc cgacatcgcc      1740
     gtgtacgtgc ggtcggacgt gtaccgcacg ctgccgcacg cgtga                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page