(data stored in ACNUC30630 zone)

EMBL: AP009256.PE610

AP009256.PE610       Location/Qualifiers
FT   CDS_pept        764901..765329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0610"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of PAB3260"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39391"
FT                   /db_xref="GOA:A1A108"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A1A108"
FT                   /protein_id="BAF39391.1"
FT                   /translation="MRQALGPVGSGAFRVKDLYIAVFPAKGGTMSTSRAVRDAANPTMT
FT                   LHDCPLNARVVVDGIDLDDRHRFRLCEIGLAPGTGLRVVQRGAFGGRVIAFGNERVAVD
FT                   GGTARAVRVRFAQDWAVQDSAAQDKTARHEENGNTHEC"
     gtgcgtcagg cgctcggacc ggtcggttcg ggcgcttttc gcgtaaaaga cttgtatatc        60
     gccgtttttc ctgctaaggg tggaaccatg agtacttcac gcgcggttcg tgacgcggcc       120
     aacccgacta tgacattgca tgactgtccg ctgaacgcgc gcgttgtcgt ggacggcatc       180
     gatttggacg atcggcatcg gttccgcctg tgcgagatcg gactggcgcc gggcaccggt       240
     ctgcgggtcg tgcagcgggg cgcgttcggc ggaagggtca tcgccttcgg caacgaacgc       300
     gtagcggtgg atggtggtac cgcgcgcgcc gtccgcgtac ggtttgcgca ggactgggca       360
     gtacaggata gtgccgcgca agacaagacc gcacggcatg aagagaacgg aaacacgcac       420
     gaatgctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page