(data stored in ACNUC30630 zone)

EMBL: AP009256.PE79

AP009256.PE79        Location/Qualifiers
FT   CDS_pept        106598..108190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BAD_0079"
FT                   /product="hypothetical protein"
FT                   /note="COG family: permeases of the major
FT                   facilitatorsuperfamily"
FT                   /note="Orthologue of BL0534"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38860"
FT                   /db_xref="GOA:A0ZZH7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZH7"
FT                   /protein_id="BAF38860.1"
FT                   /translation="MTEDNQNNEFKPQPLPGQVFIRPGIDDRPDYEKTLTPEAKAAMRR
FT                   LSVQQHPRIPEASNERPETQAARIASEGGAPLTAAAHLDVAVPNLESSFLDLRDPMTAP
FT                   DGTKPTAMQANRLVAGFALGSMLLSAPMAAFNTVLIPQTVSRLSGINRVTDLAMLVIAG
FT                   AIMTFLLNACIAVGSDHSYCRFGRRTPWIASGSVLAAICMAILSACDFLPWAVFFWLAT
FT                   QAAYAMAAIPFAAAFGERVPDKFRDRADSWHGKGLALGQLVGVAVAVALTPHAGGEGWD
FT                   GTTGFAMLVFAGWLVVAAVVTLLILPFEGASSYLPRRDVEKGDFFSQYRPPQNAPKFSV
FT                   AFAARMFAVAATAGIAVYQWYLAPNIVGNTDEAGLFGIAGAGSVVVVMAICTFVGALIA
FT                   ALLLGRVVSLFGDLRIPAVASAVLFMVAALLPLLMDDGFLAVALYALLAGFAYVVFDGA
FT                   SQSLDLAMLPDVRSVGRSLAAYSLANTFGTILGVAACAAVIVATGATVLIFAVATVSML
FT                   LAGLLTLRLKSQQ"
     atgaccgaag acaatcagaa taacgaattc aaaccgcagc cgctgcccgg ccaggtgttc        60
     atccgcccgg gcatcgacga tcgccccgat tatgagaaga ccctgactcc cgaagcgaag       120
     gcggccatgc gccggctgtc ggtgcagcag catccgcgta ttccggaagc gtccaacgag       180
     cgtccggaaa cccaggccgc gcgcatcgca tcggaaggtg gagcgcccct aaccgcggcc       240
     gcgcatcttg acgtggctgt gccgaacctc gaatcgtcct tcctcgacct gcgcgacccg       300
     atgaccgctc cggacggcac caagccgacc gcaatgcagg ccaaccggct cgttgcgggt       360
     tttgcgcttg gctcaatgct gctgtccgct ccgatggcgg cgttcaacac ggtgctcatt       420
     ccgcaaaccg tcagccgttt gtcgggaatc aaccgcgtca cggatttggc gatgctcgtc       480
     atcgcaggtg ccatcatgac gttcctgctg aatgcatgca tcgccgtcgg ttccgaccat       540
     tcctactgcc ggttcgggcg ccgtacgcca tggatcgcca gcggcagcgt attggcggct       600
     atctgcatgg cgattctttc cgcatgcgat tttctcccgt gggccgtgtt cttctggctg       660
     gccacgcagg ccgcgtatgc gatggcggcc ataccgttcg ccgccgcgtt cggcgaacgt       720
     gtgcctgaca agttccgcga ccgcgccgat tcctggcacg gcaaggggct ggcgcttggc       780
     cagctggtcg gcgtcgccgt ggctgttgcg ctgacgccgc atgccggtgg cgaaggttgg       840
     gatggcacta cgggtttcgc gatgctggta ttcgcgggtt ggcttgtcgt cgcggccgtc       900
     gttacgctgt tgatattgcc gttcgaaggg gccagcagct acctgccgcg tagggatgtt       960
     gagaaaggcg atttcttctc gcaataccgt ccgccgcaga acgcgccgaa gttttctgtg      1020
     gcattcgcgg cccgcatgtt cgccgttgcg gccacagccg gaatcgccgt atatcagtgg      1080
     tatctggcgc cgaatatcgt cggcaatacc gatgaggccg gtttgttcgg cattgccggt      1140
     gccggatcgg tggttgtggt catggccatc tgcacgtttg tcggtgcttt gattgcggcg      1200
     ttgctgcttg gccgcgtcgt cagcctgttt ggcgatctgc gtattccggc cgtcgcgtcc      1260
     gccgtgttgt tcatggtcgc tgcgctgctg ccgttgctga tggacgacgg tttcctggcg      1320
     gttgcgctgt acgccctgct tgccggcttc gcatacgtgg tgttcgatgg cgccagccaa      1380
     agcttggatc ttgcgatgct gccggatgtg cgttccgtgg gccgatcgct tgccgcttat      1440
     agtctggcca atacgttcgg cacgatactg ggcgtcgctg cctgcgccgc ggtgattgtg      1500
     gcgaccggtg ccaccgtgct gatcttcgct gtcgccactg tttcgatgct gttggcgggt      1560
     ctgctgacat tgcggttgaa atcgcaacaa tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page