(data stored in ACNUC30630 zone)

EMBL: AP009256.PRIA

AP009256.PRIA        Location/Qualifiers
FT   CDS_pept        680503..682734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BAD_0542"
FT                   /product="probable primosomal protein N'"
FT                   /note="Binding of PriA to forked DNA starts the assemblyof
FT                   the primosome_ also posseses 3'-5' helicase activity"
FT                   /note="Orthologue of BL1791"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39323"
FT                   /db_xref="GOA:A1A0U0"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0U0"
FT                   /protein_id="BAF39323.1"
FT                   /translation="MTNEDAEQLALDGLAPRKRRKRAPAVKTPAAEHPIAQVVLDIQAT
FT                   HLGQTFDYFVEEKYSAAAQPGVMVRVRFGGQRVNGIIWKRADTSATPESSIRYIERVVT
FT                   DRVLVPESMRDDMTRIADAFGGTRANILRLAVPPRVAKVESQLRVGNRDAAGTAAGKQR
FT                   LTAVDQEIYGQLQRQYGNINLLHDALQGRRFQSFVFDLLPGADHWRRCAAWMVAAALAQ
FT                   NKPAVLVLPTMREIADMTETLRSVGLKPFAPTGAANGVYDGDFAVLNAQMAPADRYRAY
FT                   LAISCGQVRCVLGTRAAMYAPVEGNALFLILDDVCYQDADGMMPYANARGVLRLRAKSH
FT                   NGVFVAMANARSAQSQWETDAAHVGDTQVSGFSTPIHALPAVTKEASPWIRWLNRDELA
FT                   RLADPTIGARVPHTAVRILSKALETGPVLLSIPQDGITEALSCSKCHRQVRCARCTGPL
FT                   ERLADGTIRCRWCGAATVQWSCPTCHNERMRVVRVGAAGTAMELARLFRGVPMVLSTPS
FT                   QPRGVVSDIGFAPQLVIATPGAEPRVRGESPAQCEYRAVAILDAWTSLYASGIDADVDT
FT                   LTGWMRAVSLCAPRTRGGQALLIGETDPVLARSLMLWNSPMLAQVEVEDRAQTALPPVF
FT                   AAACVWGRRDAVGTMLKRIGALAGGDMATIDTIAGTMPSVLGPVPIPQPRTIDSRELEG
FT                   TADRVKAVVRVPQGRRAELALRLRSASARHVASREPGELRFQMDPKERI"
     atgaccaatg aggatgccga gcagctggcg cttgacgggc ttgccccgcg caagcggcgc        60
     aaacgcgcgc ccgccgtcaa aacgccagcc gccgaacatc ccatagccca agtggtgctg       120
     gacatccagg ccacgcatct gggacagacc ttcgactatt tcgtcgagga aaaatactct       180
     gcggccgccc aacccggcgt gatggtgcgc gtccgcttcg gcgggcagcg ggtcaacggc       240
     atcatatgga aacgcgccga taccagcgcc acacccgaat catcgatacg ttacatcgaa       300
     cgtgtggtca ccgaccgtgt gctcgttccc gaatccatgc gcgacgatat gacgcgcatc       360
     gcggacgcgt tcggcggcac gcgcgccaat atcctccgcc tggcagtgcc gccgcgcgtg       420
     gcaaaagtcg aaagccagct gcgcgtcggc aatcgcgatg ccgcaggaac cgcggcgggc       480
     aaacaacggc tcaccgccgt cgaccaggag atatacggcc agttgcaacg tcaatacggc       540
     aacatcaatc tgctgcatga cgcgctgcaa ggcagacgtt tccaatcgtt cgtcttcgac       600
     ctgctacccg gtgccgacca ttggcggcgc tgcgcggcat ggatggtggc cgcggcgctc       660
     gctcagaaca agccggcggt gctggtgctg ccgaccatgc gggagatcgc cgacatgact       720
     gagaccctac ggtcggtcgg cttgaaaccg ttcgctccga ccggagccgc gaacggcgtc       780
     tatgacggcg atttcgcggt gctcaacgcg cagatggcgc cagccgaccg ttaccgggca       840
     tatctcgcga tcagctgcgg acaagtgcgt tgcgtgctgg gcacgcgcgc cgccatgtac       900
     gcgccggtgg aaggcaacgc gctgttcctc atccttgatg acgtgtgcta ccaggacgcc       960
     gacggcatga tgccgtacgc caacgcgcgc ggtgtgcttc ggctccgcgc gaaatcgcat      1020
     aacggcgtgt tcgtcgcgat ggccaatgcg cgcagcgcgc aaagccaatg ggaaaccgac      1080
     gcggcgcacg tcggagatac gcaggtgagc ggcttcagca cgcccataca cgcgttgccg      1140
     gccgtgacca aggaagcgtc tccatggatt cgctggctca atcgcgacga gctggcacga      1200
     ctcgccgatc cgaccatcgg cgcacgcgtg ccacacaccg cggtccggat actgtccaaa      1260
     gctttggaaa ccggtccggt gctgctgtcc ataccgcagg acggcatcac cgaagcgtta      1320
     agctgctcga aatgccaccg ccaagtgcga tgcgcgcgtt gcacgggacc attggaacgg      1380
     ttggcggacg gaacgattcg atgccgctgg tgcggcgccg ccaccgtgca atggtcatgc      1440
     ccgacatgcc ataacgagcg catgcgcgtg gtcagggtcg gcgccgccgg aaccgcgatg      1500
     gaactggcca gactgttccg tggcgtgccg atggtgctgt ccacgccaag ccagccaaga      1560
     ggcgtcgtgt ccgatatcgg attcgctccg caactggtca tcgccacgcc cggcgcggag      1620
     ccgcgtgtgc gcggggagag tccggcacaa tgcgaatacc gtgccgtggc catcctcgac      1680
     gcgtggacca gtttgtatgc gtccggcatc gacgccgatg tggacacgtt gaccggatgg      1740
     atgcgcgcgg tgtcgctgtg cgcgccgcgg acccgtggag gacaggcgct gctgatcggg      1800
     gaaacagatc ccgtgctcgc acgatcgttg atgctgtgga attcgccgat gcttgcccaa      1860
     gtcgaagtgg aggaccgcgc ccagaccgcg ctgccgccgg tattcgccgc ggcctgcgtg      1920
     tggggccgac gagatgcggt tgggacgatg ttgaaacgaa tcggcgcgtt ggccggtggc      1980
     gacatggcca ccatcgacac gatcgccggt acgatgccgt ccgtcttggg tccggtgccg      2040
     attccgcagc cacgcaccat cgattcacgt gaattggaag gcaccgcgga cagggtcaaa      2100
     gcagtcgtgc gcgtcccaca gggcagacgt gccgaattgg cgttgcggct gcgttcggca      2160
     agcgcccgcc acgtggcttc acgcgaacct ggggaactgc gattccagat ggatccgaag      2220
     gaacgcatct ga                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page