(data stored in ACNUC30630 zone)

EMBL: AP009256.PSTB

AP009256.PSTB        Location/Qualifiers
FT   CDS_pept        372886..373665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="BAD_0281"
FT                   /product="phosphate import ATP-binding protein pstB"
FT                   /note="COG family: ABC-type phosphate transportsystem_
FT                   ATPase component"
FT                   /note="Orthologue of BL0312"
FT                   /note="PFAM_ID: ABC_tran"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39062"
FT                   /db_xref="GOA:A1A029"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1A029"
FT                   /protein_id="BAF39062.1"
FT                   /translation="MGQRIDVNHLNIFYGDFLAVEDVNINIEANKVTAFIGPSGCGKST
FT                   VLRTLDRMHEIIPGAHCEGEVLLEGKNLYDKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVKLNNRKISKSDADDLVEWALRGANLWNEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLINELKNEYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFTDTTTMFNNPQNEEAERYVSGRFG"
     atgggacaac gtattgatgt caaccatctg aacatcttct acggcgactt cctggccgtg        60
     gaagacgtga acatcaacat cgaagccaac aaggtcaccg cgttcatcgg accttccggc       120
     tgtggcaagt ccaccgtgct gcgcaccctc gatcgcatgc acgagatcat tccgggcgcc       180
     cactgcgaag gcgaggtgct gctggaaggc aagaacctgt acgacaagga tgtggatccg       240
     gtcgccgtcc gtcgtgacgt cggcatggtg ttccagcgtc cgaacccgtt cccgaccatg       300
     tccattcgcg agaacgtgct ggccggtgtg aagctcaaca accgcaagat ctccaagtcc       360
     gacgcggatg atctggtcga gtgggccctg cgtggcgcca acctgtggaa cgaggtcaag       420
     gatcgtctgg acaatccggg catcggcctg tccggcggcc agcagcagcg tctgtgcatc       480
     gcacgcgccg tggccgtgca cccgcaggtg ctgctcatgg acgaaccgtg ctccgccctc       540
     gacccgatct ccaccctggc cgtggaggat ctgatcaacg agctgaagaa cgagtacacc       600
     atcgtgatcg tgacgcacaa catgcagcag gccgcccgta tcgccgacta caccgccttc       660
     ttcaacctga aggccgtcgg ccagccgggt cacctcgagt acttcaccga caccaccacg       720
     atgttcaaca acccgcagaa cgaagaagcc gaacgttacg tctccggacg ttttggctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page