(data stored in ACNUC30630 zone)

EMBL: AP009256.PSTS

AP009256.PSTS        Location/Qualifiers
FT   CDS_pept        369534..370730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="BAD_0278"
FT                   /product="phosphate-binding transport protein of ABC
FT                   transporter system"
FT                   /note="COG family: ABC-type phosphate transportsystem_
FT                   periplasmic component"
FT                   /note="Orthologue of BL0315"
FT                   /note="PFAM_ID: PstS"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39059"
FT                   /db_xref="GOA:A1A026"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1A026"
FT                   /protein_id="BAF39059.1"
FT                   /translation="MATTENRKIRNIRHLNVDRGKRIMRNSILVRSIAAVSGIVMLASV
FT                   AACGDNITASTDSSAKSDTKTETVSGNFSGAGASSQQAAVEAWIAGFQGTNPDAKVAYN
FT                   PSGSGAGVSTFLTGATAWAGSDASLADNEVEQSKSVCASGTAFDIPVYISPIAVVFNLQ
FT                   GVSGKGKTLNMDAETIAKIFDGKITKWNDDAIKKQNPKVDLPDLDITVVHRSDKSGTTK
FT                   NFLSYVKDAAGDAWSYDLGENWPNEVGQGAKGTSGVISTVQQADGTIGYADASQAGDLG
FT                   TVAVKVGDDYVPFSAEAAAKVVDASPLDDSAKGDNRVVVKLDHNTTEKGAYPIVLVSYD
FT                   VACPAYKDANTAKFVKSWLTYVTSDEGQQTAASAAGSAPMSNTLRQKVVKSIDAIKTK"
     atggcgacaa cagaaaatcg aaaaatcaga aacatacgcc atctgaatgt tgacagaggg        60
     aaaagaataa tgcgtaactc cattctcgta cgctccatcg ccgctgtgtc cggcattgtg       120
     atgctggctt ccgtcgcggc ttgcggtgac aacatcaccg cttccaccga ttcttcggcc       180
     aagtccgata ccaagaccga aaccgtttcc ggcaacttct ccggcgctgg cgcttcttcc       240
     cagcaggccg ccgtcgaagc ttggatcgcc ggcttccagg gcaccaaccc ggacgccaag       300
     gtcgcttaca acccgtccgg ttccggcgct ggcgtgtcca ccttcctgac cggtgcaacc       360
     gcatgggccg gctccgacgc ctccctcgcc gataacgagg tcgagcagtc caagagcgtg       420
     tgcgcttccg gcaccgcctt cgacatcccg gtctacattt ccccgatcgc cgtcgtcttc       480
     aacctgcagg gcgtgtccgg caagggcaag accctgaaca tggatgccga gaccatcgcc       540
     aagatcttcg acggcaagat caccaagtgg aacgatgacg ccatcaagaa gcagaacccg       600
     aaggtcgatc tgcctgacct cgacatcacc gtggtgcacc gttccgacaa gtccggcacc       660
     accaagaact tcctgagcta cgtcaaggac gccgctggcg acgcatggag ctacgacctc       720
     ggcgagaact ggccgaacga ggtcggccag ggcgccaagg gcacttccgg cgtgatctcc       780
     accgtgcagc aggctgacgg caccatcggt tacgccgatg cctcccaggc cggcgatctg       840
     ggcaccgtgg ccgtgaaggt cggcgacgat tacgtcccgt tctccgctga agccgccgcc       900
     aaggtcgtgg acgcctcccc gctcgacgat tccgccaagg gtgacaaccg cgtggtcgtc       960
     aagctcgacc acaacaccac cgagaagggc gcctacccga tcgtgctggt ctcctacgac      1020
     gtcgcctgcc cggcatacaa ggacgccaac accgccaagt tcgtcaagtc ctggctcacc      1080
     tacgtgacca gcgacgaagg ccagcagacc gccgcttccg cagccggctc cgctccgatg      1140
     tccaacaccc tgcgtcagaa ggtcgtcaag tccatcgacg ccatcaaaac caagtga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page