(data stored in ACNUC30630 zone)

EMBL: AP009256.PURE

AP009256.PURE        Location/Qualifiers
FT   CDS_pept        643628..644125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BAD_0515"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /note="Air carboxylase AirC"
FT                   /note="COG family:phosphoribosylcarboxyaminoimidazole
FT                   (ncair) mutase"
FT                   /note="Orthologue of BL1130"
FT                   /note="PFAM_ID: AIRC"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39296"
FT                   /db_xref="GOA:A1A0R3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0R3"
FT                   /protein_id="BAF39296.1"
FT                   /translation="MADNKPEVAVIMGSASDWETMKHACEMLDQFEVPYMKQVISAHRT
FT                   PELMGEFAHNARANGLKVIIAGAGGAAHLPGMVAAQTTLPVIGVPVRSHALSGWDSLLS
FT                   IVQMPGGIPVATTAVGNSGATNAGLLAVSILSATDERLAKALQDYRDSLKEKVAESNAQ
FT                   LV"
     atggcagaca acaagcctga agtcgcggtg atcatgggat cggcaagcga ttgggagacc        60
     atgaagcacg catgcgagat gctcgaccag ttcgaggtgc cgtacatgaa gcaggtgatt       120
     tccgcgcacc gcaccccgga actgatgggt gagttcgcgc acaacgcccg tgccaacggg       180
     ctgaaggtca tcatcgccgg cgcgggcggc gcggcccacc tgccgggcat ggtcgcggcg       240
     cagaccacac tgccggtcat cggcgtaccg gtacgctccc acgcgctgtc cggctgggat       300
     tcgctgctgt ccatcgtgca gatgccgggc ggcattccgg tggccaccac cgccgtcggc       360
     aactccggcg caaccaacgc cggcctgctc gcggtgagca ttctgagcgc caccgacgag       420
     cgactggcca aggcgctgca ggactatcgt gactccctga aggaaaaggt ggctgaatcc       480
     aatgcccagc ttgtctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page