(data stored in ACNUC30630 zone)

EMBL: AP009256.RECR

AP009256.RECR        Location/Qualifiers
FT   CDS_pept        189152..189754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BAD_0138"
FT                   /product="recombination protein recR"
FT                   /note="COG family: recombinational DNA repair protein"
FT                   /note="Orthologue of BL0499"
FT                   /note="PFAM_ID: RecR"
FT                   /note="PFAM_ID: Toprim"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38919"
FT                   /db_xref="GOA:A0ZZN6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZN6"
FT                   /protein_id="BAF38919.1"
FT                   /translation="MALAYDGAIQRLIDAFANLPGIGPKGAQRIAFYLLNAPDEESQAL
FT                   IDAITEVKEKVRFCDICGNVCETSPCPVCADPRRDHSVICVVEEPKDVMSIERTREYRG
FT                   MYHVLGGVINPMANVQPSDLNIAKLIERLKDSEVKEVILALNPNVEGEATTSFLSQLLS
FT                   QTDIKVTRLASGLPVGGDLEYADEITLGRALAGRRAV"
     atggctttgg cctatgacgg cgccatccaa cgactcatcg acgcgttcgc caacctgccc        60
     ggcatcgggc cgaaaggcgc gcaacgcatc gccttctacc tgctcaacgc gcccgatgag       120
     gaatcgcagg cactgatcga cgccatcacg gaagtcaagg aaaaagtacg gttctgcgat       180
     atctgcggca acgtgtgcga aaccagccca tgcccggtat gcgccgaccc acgccgcgac       240
     cacagcgtga tctgcgtggt cgaagagccg aaggacgtga tgagcatcga acgcacccgc       300
     gaataccgag gcatgtacca tgtgctgggc ggcgtcatca acccgatggc caacgtgcag       360
     ccaagcgacc tcaacatcgc caaactcatc gaacggctta aggacagcga agtcaaggag       420
     gtgatcctcg cgctcaaccc gaacgtggaa ggcgaggcca ccaccagctt cctttcgcag       480
     ctgctgagcc agaccgacat caaggtgacg cgccttgcca gcggcctgcc ggtgggcggc       540
     gacctcgaat acgccgacga gatcaccctg ggccgtgcgc tcgccggccg tcgcgccgtc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page