(data stored in ACNUC30630 zone)

EMBL: AP009256.RIBD

AP009256.RIBD        Location/Qualifiers
FT   CDS_pept        524261..525214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="BAD_0418"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /note="Orthologue of SAK_0872"
FT                   /note="identified by similarity to SP:P17618"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39199"
FT                   /db_xref="GOA:A1A0G6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0G6"
FT                   /protein_id="BAF39199.1"
FT                   /translation="MAARRTAGRTCPFPDRSRRLRDVRCNVCGLDWCNMLGVMEDMLQY
FT                   RESMAQALELARKGAGWVDPNPLVGAVVVRDGEVLATGYHDRYRGPHAERMAFDYADAH
FT                   GIDLTGATVIDTLEPCCHVGSQPACTALILAHGIARVVVGSVDPNPIVAGKGLRILEEA
FT                   GVEVVRDVMREECDAINRHFFHYITTGKPYIVDGRRRAGESDSEYAVRRRELYATYAAV
FT                   LAGTESDVPDESFAHFNGPVQAVGADEVVIGGHRPLLLEAGALACTDPDEWLSELGKRK
FT                   IDSLIVESDEAFERLSMALPKRLKRHSCVVGRVSRL"
     atggctgcga gacggacggc tgggcgaacc tgtccattcc ctgaccgttc gcgtcggctt        60
     cgggatgtga ggtgcaacgt gtgcggcttg gactggtgca atatgcttgg ggtcatggaa       120
     gacatgttgc aataccgcga atctatggcg caggctcttg aactggcccg caagggtgcg       180
     ggatgggtgg acccgaatcc gctggtaggc gcggtggtgg tacgtgatgg cgaggttctc       240
     gccaccggat accatgaccg gtatcgtggc ccgcatgcgg agcgtatggc gttcgactat       300
     gccgacgcgc acggcatcga tctgactggc gccacggtca tcgacacgct tgaaccctgc       360
     tgccatgtcg gatcgcagcc ggcgtgcact gccttgattc tggcgcacgg catcgcacgc       420
     gtggtggtcg gatcggttga cccgaacccg attgtagcgg gcaaaggcct tcgcatcctt       480
     gaggaagcgg gcgtcgaagt ggttcgcgac gtgatgcggg aggaatgcga cgccatcaat       540
     cgccatttct tccactacat caccacggga aagccgtaca ttgtggacgg cagaaggcgt       600
     gcgggtgaat cggactctga gtatgcggtc cgtcggcgcg aactatatgc cacatatgcg       660
     gcggtgcttg ccggaactga atcggacgtt cctgacgagt ctttcgcgca tttcaacgga       720
     ccggtccaag ccgtcggcgc agacgaagtg gtgattggcg gccacaggcc gttactcctg       780
     gaggccggcg cgctcgcctg cacggatcca gacgaatggc tgagtgagct gggcaagcgc       840
     aaaatcgaca gcctcatcgt ggaaagcgac gaagcattcg agcggttgtc catggctttg       900
     ccaaaaagac tgaagcgcca ttcgtgcgtt gttggccgtg tatctcgctt atag             954
//

If you have problems or comments...

PBIL Back to PBIL home page