(data stored in ACNUC30630 zone)

EMBL: AP009256.RPLK

AP009256.RPLK        Location/Qualifiers
FT   CDS_pept        322357..322788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BAD_0247"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG family: ribosomal protein L11"
FT                   /note="Orthologue of BL1290"
FT                   /note="PFAM_ID:Ribosomal_L11"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39028"
FT                   /db_xref="GOA:A0ZZZ5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZZ5"
FT                   /protein_id="BAF39028.1"
FT                   /translation="MAPKKKVSALLKLQIQAGKANPAPPLGPALGSHGVNIMDFCKQYN
FT                   AATQDKMGQVIPVEITVYEDRSFTFILKTPPAAALLKKAAGIQKGTENPLTHKVGSVTK
FT                   AQVREIAEIKMADLSARDVEAGMKIIAGTARSMGITVTD"
     atggctccta agaagaaagt ctcggcgctt ctcaagctcc agattcaggc cggcaaggcc        60
     aacccggctc cgccgctggg cccggctctg ggttcccatg gcgtgaacat catggacttc       120
     tgcaagcagt acaacgctgc cacgcaggac aagatgggcc aggtcatccc tgttgagatc       180
     accgtttacg aagatcgttc cttcaccttc atcctgaaga ccccgccggc agcagctctg       240
     ctgaagaagg ccgctggcat ccagaagggt accgagaacc cgctgaccca caaggtcggc       300
     tccgtcacca aggctcaggt ccgtgagatc gctgaaatca agatggctga tctgtccgca       360
     cgcgacgtcg aagccggcat gaagatcatc gcgggcaccg cccgttcgat gggtatcacg       420
     gttaccgact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page