(data stored in ACNUC30630 zone)

EMBL: AP009256.RPLO

AP009256.RPLO        Location/Qualifiers
FT   CDS_pept        431897..432343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BAD_0340"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Associates with 23S ribosomal RNA and is involvedin
FT                   50S ribosome assembly"
FT                   /note="Orthologue of BL1599"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39121"
FT                   /db_xref="GOA:A1A088"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A088"
FT                   /protein_id="BAF39121.1"
FT                   /translation="MADILQMHDLKPAPGANKDRIRVGRGEGSKGKTSGRGDKGTKKRY
FT                   QVRPGFEGGQLPLYMRLPKLRGFKNPFKKEYQVVNVAVLAELFPQGGEITVADLVAKGA
FT                   VRNGFPVKVLGDGEVSAAYTLKGVKASASAKSKIEAAGGSISED"
     atggcagaca ttctgcagat gcatgacctg aagccggctc cgggtgccaa caaggatcgt        60
     atccgcgttg gccgtggtga aggctccaag ggtaagacct cgggccgtgg cgacaagggc       120
     accaagaagc gctatcaggt tcgtccgggc ttcgaaggtg gccagctgcc gctgtacatg       180
     cgccttccga agctgcgtgg cttcaagaac ccgttcaaga aggaatacca ggtcgtcaac       240
     gtggctgttc ttgcggaact gttcccgcag ggcggcgaga tcaccgtggc tgatttggtt       300
     gccaagggtg ccgtccgcaa cggcttcccg gtcaaggtcc tgggcgacgg cgaggtttcg       360
     gctgcctaca ctctcaaggg tgtcaaggct tccgcttccg ccaagtccaa gatcgaggct       420
     gctggcggct ccatttccga ggattga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page