(data stored in ACNUC30630 zone)

EMBL: AP009256.RPMF

AP009256.RPMF        Location/Qualifiers
FT   CDS_pept        complement(295864..296058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BAD_0224"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39005"
FT                   /db_xref="GOA:A0ZZX2"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0ZZX2"
FT                   /protein_id="BAF39005.1"
FT                   /translation="MALPKYKTSRANTHSRRANWKAKAAQTVTCPNCGAPTLPHMACPS
FT                   CGSFRGRVYREAVRSIHTK"
     atggcactgc ctaagtacaa gacctcgcgc gcgaataccc attctcgccg cgcaaactgg        60
     aaggccaagg ccgcccagac cgttacctgc ccgaactgcg gcgctccgac gctgccgcac       120
     atggcatgcc cgagctgcgg ttccttccgc ggccgcgtgt accgcgaggc tgtccgctcc       180
     atccacacca agtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page