(data stored in ACNUC30630 zone)

EMBL: AP009256.RPMG

AP009256.RPMG        Location/Qualifiers
FT   CDS_pept        388234..388404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BAD_0293"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39074"
FT                   /db_xref="GOA:A1A041"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A041"
FT                   /protein_id="BAF39074.1"
FT                   /translation="MASKSADIRPGITLACTECKERNYITTKNRRNTPDRLELKKFCSR
FT                   CGKQTVHRETR"
     atggcaagca agagcgccga cattcgtccg ggcatcacgc tggcatgcac cgagtgcaag        60
     gagcgtaact acatcacgac gaagaaccgc cgtaacacgc cggatcgtct tgagctcaag       120
     aagttctgct cccgctgcgg caagcagacc gtgcatcgcg agacccgctg a                171
//

If you have problems or comments...

PBIL Back to PBIL home page