(data stored in ACNUC30630 zone)

EMBL: AP009256.RPOZ

AP009256.RPOZ        Location/Qualifiers
FT   CDS_pept        678772..679056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="BAD_0540"
FT                   /product="RNA polymerase omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39321"
FT                   /db_xref="GOA:A1A0T8"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0T8"
FT                   /protein_id="BAF39321.1"
FT                   /translation="MAFGTEPTPTGLADPPIDDLMEHADSKYALAIFAAKRARQINSYF
FT                   TQLNEGLLQNVGPLVEYQNQEKPLSIAFREINSGLLEETLGEDDLTEGN"
     atggcattcg gcactgagcc aaccccgacc ggtcttgcgg atccgccgat cgacgatttg        60
     atggagcatg cggactccaa gtacgctctg gccattttcg cggccaagcg tgcccgccag       120
     atcaattcct atttcaccca gctcaatgag ggtctgctgc agaacgtcgg cccgctggtg       180
     gaataccaga atcaggagaa gccgctgtcc atcgcgttcc gcgagatcaa cagtggtctg       240
     cttgaggaaa cccttggtga ggacgatctg accgaaggca actga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page