(data stored in ACNUC30630 zone)

EMBL: AP009256.RPSG

AP009256.RPSG        Location/Qualifiers
FT   CDS_pept        665136..665606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BAD_0531"
FT                   /product="30S ribosomal protein S7"
FT                   /note="One of the primary rRNA binding proteins_ it
FT                   bindsdirectly to 16S rRNA where it nucleates assembly of
FT                   thehead domain of the 30S subunit. Is located at the
FT                   subunitinterface close to the decoding center"
FT                   /note="Orthologue of BL1099"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39312"
FT                   /db_xref="GOA:A1A0S9"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A0S9"
FT                   /protein_id="BAF39312.1"
FT                   /translation="MSRKGPSKKHQLLPDPIYGSTVVAQLINKILLDGKKSIAEDIVYS
FT                   ALDMVKEKTDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPGRANTLSLRWL
FT                   TDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW"
     atgtcacgta aaggaccttc caagaagcat cagctgctgc cggatccgat ctacggttcc        60
     accgttgtgg cacagctcat caacaagatt ctgcttgacg gcaagaagtc gatcgccgag       120
     gacatcgtct acagcgctct cgacatggtc aaggagaaga ccgaccagga gccggtcgcc       180
     gttctcaagc gcgctctgga caacatccgt ccgtccctcg aggttcgctc ccgccgtgtc       240
     ggtggcgcta cctaccaggt cccggtcgaa gtgaagccgg gccgcgccaa cacgctgtcc       300
     ctgcgctggc tcaccgactt ctcccgcgcc cgtcgcgaga agaccatggc tgagcgtctg       360
     gccaacgaaa tcctcgatgc ctccaacggc ctcggtgctt ctgtcaagcg ccgcgaggat       420
     actcataaga tggcagaggc caacaaggcc ttcgctcatt accgctggta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page