(data stored in ACNUC30630 zone)

EMBL: AP009256.RPSM

AP009256.RPSM        Location/Qualifiers
FT   CDS_pept        435194..435604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BAD_0345"
FT                   /product="30S ribosomal protein S13"
FT                   /note="Located at the top of the head of the 30S subunit_it
FT                   contacts several helices of the 16S rRNA"
FT                   /note="Orthologue of BL1604"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39126"
FT                   /db_xref="GOA:A1A093"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1A093"
FT                   /protein_id="BAF39126.1"
FT                   /translation="MQDLRKTEGIAMARLAGVDIPNEKRIEIALTYIFGVGRTRAKETL
FT                   AATGINPDIRVKDLTDEQLITLRDYLEGNYKIEGDLRREIDADIRRKIQINCYQGQRHR
FT                   KGLPVRGQRTKTNARTRKGPKRTVAGKKKATK"
     gtgcaagacc tgcggaaaac agaaggaatc gcaatggcac gtcttgccgg agtcgacatc        60
     cccaatgaga agcgcatcga gatcgccctc acctacatct ttggtgttgg tcgtactcgt       120
     gccaaggaaa cgcttgccgc gaccggtatc aatccggaca ttcgcgtcaa ggatctgacg       180
     gatgagcagc tgattacgct gcgtgattac cttgagggta actacaagat cgagggtgat       240
     ctgcgtcgtg aaatcgatgc ggacatccgc cgtaagatcc agatcaactg ctaccaaggc       300
     cagcgtcacc gtaagggact tcctgtgcgc ggtcagcgca ccaagaccaa tgctcgtacc       360
     cgcaagggcc cgaagcgcac ggtcgccgga aagaagaagg ccaccaagta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page