(data stored in ACNUC30630 zone)

EMBL: AP009256.SECY

AP009256.SECY        Location/Qualifiers
FT   CDS_pept        432536..433909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BAD_0341"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="Orthologue of BL1600"
FT                   /note="With SecE and SecG forms a protein-conductionchannel
FT                   in the inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39122"
FT                   /db_xref="GOA:A1A089"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A1A089"
FT                   /protein_id="BAF39122.1"
FT                   /translation="MRRCARRWKEPQVRTLIQALKTKELRNKILFTLGIIIIYRIGSFI
FT                   PTPGVDYTVVQQCVGKMNNASENFIGLVNLFSGGAMLQLSIFALGVMPYITASIVIQLL
FT                   RVVIPRFEALHKEGQSGEAKLTQYTRYLTIGLAVLQSTTILVTARSGALFNYQCSQVVP
FT                   DGSVWNLVVMVLIMTGGTGLIMWMAELVTDKGLGQGMSILIFMSICSGFLPQLWEIGWG
FT                   TNGTDGNWGKFAAVVGTLLVIMILVIYVELAQRRIPVQYTRRMIGRKMYGGSSTYLPLK
FT                   INMSGVIPPIFASSILAVPTLIAQFGNSDQSWVKWINSNLANTTSVWYIALYALMIVFF
FT                   CFFYTEITFNPDETADNMKQYGGFIPGIRAGSATSNYLSYVMNRLNTVGAVYLLFVALI
FT                   PTVLIMALNLNTKLPFGGTTILIIAGVGLDTLRQAKAQTEQFQYAGFLFEDTDHKEGK"
     gtgcgcaggt gcgcacgacg atggaaggaa ccccaggtga ggacgttaat ccaggccttg        60
     aagaccaagg aattgaggaa taaaatcctc ttcacccttg gtatcatcat catttatcgt       120
     atcggttcat tcatcccgac ccctggcgtc gattacaccg tcgtccagca gtgcgtcggc       180
     aagatgaaca acgcttctga gaactttatc ggtctggtga acctcttctc cggcggcgcc       240
     atgctgcagc tgtcgatttt cgcattgggc gtcatgccgt acatcaccgc atcgatcgtc       300
     atccagctgc tgcgtgtggt catccctcgt ttcgaggcac tgcacaagga aggccagtcc       360
     ggcgaagcca agctgaccca gtacacccgt tatctgacca tcggccttgc cgtgctgcag       420
     tccaccacca ttctggtgac cgcacgttcc ggcgcgctgt tcaactacca gtgctctcag       480
     gttgttccgg acggttccgt gtggaacctt gtggtcatgg tgctcatcat gaccggcggc       540
     accggcctca tcatgtggat ggccgaattg gttaccgata agggcctcgg ccagggtatg       600
     tccatcctta tcttcatgtc catctgctcc ggcttcctgc cgcagctgtg ggagatcggc       660
     tggggcacca acggcaccga tggcaattgg ggcaagttcg ccgcggtcgt cggcaccctg       720
     ctggtcatca tgatccttgt catctacgtc gagcttgccc agcgtcgtat tccggtgcag       780
     tacacccgcc gtatgatcgg ccgcaagatg tacggtggct cctccaccta cctgccgctg       840
     aagatcaaca tgagcggcgt catcccgccg atcttcgcat cctccatcct ggccgtgccg       900
     acgctgatcg cgcagttcgg caattccgac cagtcctggg tcaagtggat caactccaac       960
     ctggccaaca ccacatccgt gtggtacatc gcactgtacg cgctgatgat cgtgttcttc      1020
     tgcttcttct acacggagat caccttcaac ccggacgaga ccgccgacaa catgaagcag      1080
     tacggcggct tcattccggg catccgcgcg ggaagcgcca ccagcaacta cctgagctac      1140
     gtgatgaacc gtctgaacac ggtcggcgcc gtctacctgc tgttcgtggc gcttatcccg      1200
     acggtgctca tcatggcgct gaacctgaac accaagctgc cgttcggcgg aaccaccatc      1260
     ctgatcatcg caggcgtcgg cctcgacacc ctgcgccagg ccaaggccca gaccgaacag      1320
     ttccagtacg ctggcttcct gttcgaggac accgaccaca aggaaggtaa gtaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page