(data stored in ACNUC30630 zone)

EMBL: AP009256.YWBC

AP009256.YWBC        Location/Qualifiers
FT   CDS_pept        413861..414349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywbC"
FT                   /locus_tag="BAD_0314"
FT                   /product="hypothetical protein"
FT                   /note="Orthologue of BLi04061"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39095"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1A062"
FT                   /protein_id="BAF39095.1"
FT                   /translation="MHSRHRRIAHILITKGENQSYSSLSGGNFMAKAMSEFTTDLQHSG
FT                   MPAKDLDETIEFYTKKLGFELAGLFHNGENRCAFLRYGHLTIETWEGDPAPLTTGAINH
FT                   WAFDTPDIEAAFENAKELGLNFKDNEIQHIDSFWEHGIRYFNVYGPNGETIEFCQIVK"
     atgcacagcc gacatcgccg catagcgcat atcctaatca caaaagggga aaatcaatcg        60
     tattcatcgt tatcaggagg taattttatg gcgaaagcaa tgtctgaatt cactaccgat       120
     ctgcagcatt ccggcatgcc ggcgaaggat ctcgacgaaa ccatcgaatt ctatacgaag       180
     aagcttggtt tcgaactggc cggactgttt cataacggcg aaaatcgttg tgcattcctg       240
     cgttacggcc atctgaccat cgaaacgtgg gagggcgatc cggctccgct gaccactggt       300
     gccatcaacc attgggcatt cgacactccc gacatcgaag ctgcattcga aaacgcgaag       360
     gaactcgggc tgaatttcaa agataacgaa atccagcata tcgacagctt ctgggagcat       420
     ggcatccgct acttcaacgt atacggaccg aacggcgaaa ccattgaatt ctgtcagatt       480
     gtcaaataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page