(data stored in ACNUC7421 zone)

EMBL: AP009493.PE1

AP009493.PE1         Location/Qualifiers
FT   CDS_pept        908..2791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_1t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_1t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16830"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKJ9"
FT                   /protein_id="BAG16830.1"
FT                   /translation="MRGAQPDPRRQQMVALNIEFAVFEVGDGVEERRFNAPLTALTGET
FT                   GSGKSTLLEAVWWTLGVDRTKLMHAAAACARVGFTARIGASRWRITRSTTDPKEDVAFT
FT                   NITTGVEEQHPVKGSEARRSAADVFQDLLGIPRLGTGRTRVTLDLLQPWIYARQDSLPT
FT                   HYLGGQGKEQRVSVGRVLLGADDETVDALRQDSTDKTKKWRSATNRVKKILRDREEHEL
FT                   PSLEDLQRRAAQWTAQHQEESARVRGANAELSRLQHELAALEQKASTADEARRAARTAA
FT                   DDRERTARLLEAAAAEARGRLAGLREAATDPSLCPQCVRPLDLTGLSQDDCPVCRRFDP
FT                   ERQQRTHQFQRRMAEAQQGAERAREAARRAAQAAEDARGRAGEADRAGTEAWASARAFV
FT                   QDVIAPQQQIVVEAEASVRELAARLEQNTEHLRELTELTGLREQLPKLQELKEAAEAAY
FT                   TAARNDTDLMVKQGTDRWSDHLLRRMQACDPEITTASVSPQDFSVTVNGGAFDSTVVTG
FT                   HGRTRINVSTLLALRDTAREVPAMPVPQFLMVDSPFTGLGNSPKDQRTGAALLEGLTEL
FT                   ATSQHPSGTGGQVIIACTELLGPPQAAVREILTSLADGAIPGLPPRDSDTP"
     gtgcggggag cacagccgga tccgcggagg cagcagatgg tcgcgttgaa tatcgagttc        60
     gcagtctttg aggtcggcga tggagtagaa gagcgccgct tcaacgctcc actcacggca       120
     ttgaccggag agacgggttc agggaagagc acgttgctgg aagccgtgtg gtggacgctc       180
     ggcgtggacc gcacgaaact gatgcacgcg gctgcagcat gcgctcgtgt cggcttcaca       240
     gcacgcatcg gggcgtcacg gtggcgtatc acccgcagca cgacagatcc gaaggaggac       300
     gtggccttca ccaacatcac gacaggtgtc gaggagcagc atccggtcaa aggcagcgaa       360
     gcacgcagat ccgccgccga cgtcttccag gacctgctcg gcatccccag gctgggcact       420
     gggcggaccc gcgtcactct ggacctgctg caaccgtgga tctacgcacg ccaggacagt       480
     ctgcccaccc actacctcgg cggtcagggc aaggagcagc gggtctccgt ggggcgggtg       540
     ctgctgggag ccgacgacga gaccgtcgat gcgttgcgcc aggactcgac cgacaagacc       600
     aagaagtggc ggtccgcaac gaaccgggtg aagaagatcc tccgggaccg cgaggagcac       660
     gagctgccgt ccctggaaga tctgcagcgc cgcgccgccc agtggacagc gcagcaccag       720
     gaagaatccg ctcgggtccg tggcgcaaac gctgagctca gccgactgca gcatgaattg       780
     gccgcactgg aacagaaggc ctccaccgct gacgaggcgc gccgggccgc ccggacagca       840
     gctgacgacc gggagcggac ggcgcgcctg ctggaggcgg ctgctgctga agcccgcggg       900
     cgtctcgctg ggctccgaga ggccgcaacc gatcccagcc tctgccctca atgcgtgcgg       960
     ccgcttgacc tgacagggct gtcgcaggac gactgccctg tgtgccggcg gttcgacccc      1020
     gagcgccagc agcgcaccca ccaattccag cggcggatgg ccgaggcgca acaaggtgcc      1080
     gagcgcgctc gtgaagcagc ccgccgggcg gcacaggccg ccgaggacgc ccgaggccgg      1140
     gccggcgaag ccgaccgagc cgggacggag gcctgggcca gcgcccgggc cttcgtccag      1200
     gacgtgatcg caccacagca gcagatcgtg gtcgaggcgg aagcctccgt gcgggaactg      1260
     gccgcccggc tcgagcagaa caccgagcac cttcgggagc tcaccgagct gaccggacta      1320
     cgcgaacagc tgccgaagct ccaggagctc aaagaagctg ccgaagccgc atacaccgcg      1380
     gcacgcaacg acaccgacct gatggtgaag cagggcaccg accggtggtc ggaccacctg      1440
     ctgcgccgca tgcaggcatg tgatccggag atcaccaccg cctcggtcag cccgcaggac      1500
     ttctccgtca ccgtcaacgg aggagcgttc gattcgactg tggttaccgg ccacggcaga      1560
     acacggatca acgtcagcac cctgctggca ctgcgcgaca ccgcacggga agtccccgcc      1620
     atgccggtgc cccagttcct gatggtcgac agccccttca ccggtctcgg caacagcccc      1680
     aaggaccagc gcaccggcgc cgccctgctc gaaggcctca ccgaactcgc gacctcgcaa      1740
     cacccctcgg gcaccggcgg gcaagtcatc atcgcctgca ccgaactgct cggccctccc      1800
     caggcagcag tacgtgagat cctcaccagc ctggccgacg gcgccatccc cggcctgccc      1860
     ccgcgcgact ccgacacacc gtag                                             1884
//

If you have problems or comments...

PBIL Back to PBIL home page