(data stored in ACNUC7421 zone)

EMBL: AP009493.PE100

AP009493.PE100       Location/Qualifiers
FT   CDS_pept        99586..100347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_100t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_100t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16929"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA6"
FT                   /protein_id="BAG16929.1"
FT                   /translation="MRPHDYVRRPFVSRPSGVLLRHGPGRHAMSSASGPNSCPTPSDRT
FT                   TPGRQWEIFLVAANLSGPDLEVISVSQLAAEVQLRNDTVGAVAGFLQAVGLLRGARGNY
FT                   ALTSAGWAIAEMHKQDETQARLLLQAQFLEHWPAASTLECLHDAPVDQKTLGRRLHKDL
FT                   PGKSRRGLYLIEWLVRALIVQRDSAMRISPSAALLASGRRSATASGPEPQRMAEQGTLM
FT                   GMTRDELRSLPPRKYIAVLDQLAALVALDPA"
     atgaggcctc acgactatgt acggcgcccc ttcgtctccc gcccttcagg cgtcctcctt        60
     cgccacgggc cagggaggca tgcgatgagt tccgcctctg ggccgaacag ttgcccgacc       120
     ccctctgaca ggaccacgcc cggcagacaa tgggagatct tcctggtcgc cgccaacctc       180
     agcggacccg acctggaggt catctccgtg tcgcagctcg ccgcggaggt gcaactgcgc       240
     aatgacacgg tcggcgcggt ggcgggcttc ctgcaggcag tcggtcttct gcgaggggcc       300
     cgcgggaact acgccctgac atctgctggc tgggcgattg ctgagatgca caagcaggat       360
     gagacccagg cgcgtctgct gctccaggcg cagttcctgg agcactggcc ggcggccagc       420
     actctcgaat gtctgcacga tgcgccggtg gatcagaaga cactcgggcg tcgtctgcac       480
     aaggacctcc cgggcaagtc caggcgaggg ctctatctga tcgagtggct ggtacgggca       540
     ctgatcgtcc aacgggattc cgccatgcgg atctccccgt ccgcggcgct gctcgcatcg       600
     ggccgcaggt ccgccacagc gtctggcccg gaaccgcagc gaatggcgga gcaggggacg       660
     ttgatgggca tgacccgcga tgagctgagg tcgcttccgc ctcggaagta catcgccgtg       720
     ctcgaccagc tggcggcgct cgtagcgctc gaccctgcct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page