(data stored in ACNUC7421 zone)

EMBL: AP009493.PE102

AP009493.PE102       Location/Qualifiers
FT   CDS_pept        100727..101578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_102t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_102t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16931"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA8"
FT                   /protein_id="BAG16931.1"
FT                   /translation="MPLMPLFRGRFFDPVIPFSKKQEMLPSAAGSLPRCRFRRVDPAVV
FT                   EARFVDGAGQEHQVPWLHAAAESPLEECVPVQRFPVLKGRRVAPGWWWAATSGRHVHYG
FT                   FGAMRTQVMLLDRDPQVTALACRPVELMWRGRGGKVVSHAPHLMARLADGSGVLIDCAG
FT                   ARGAGRRLIQRAVHVEAAAEAAGWHYRVVGAPTPAVEANVRWLAGYRHPRCASSGLSSV
FT                   SECFRMPRPLVEGVRLLGDPIAVWPAVFHALWRGVLSTPLHRPLHERALTVSAYPGAGA
FT                   HL"
     atgcccctaa tgcctctctt ccgaggaagg ttcttcgatc ccgtgatccc cttttccaag        60
     aagcaggaaa tgctgccgtc tgccgcaggt tccttgcctc gctgcagatt ccgtcgggta       120
     gatcccgcgg tggtggaggc ccggtttgtg gatggcgccg gtcaggagca tcaggttccg       180
     tggcttcatg cggctgcgga gagtccgctg gaggagtgcg ttcctgtgca gcggttcccg       240
     gtgctgaagg ggcgtcgggt tgcgccgggt tggtggtggg cggcgacgtc cgggcgtcat       300
     gtccactacg ggttcggggc gatgcggacc caggtgatgc tgctggacag ggatccgcag       360
     gtgaccgctc tggcctgccg accggtggaa ctgatgtggc ggggccgggg tgggaaggtc       420
     gtgtcgcatg cgccgcatct gatggcaagg cttgccgatg gcagtggtgt gctcatcgac       480
     tgtgcgggtg cgcgtggtgc tggccggcgt ctaatccagc gggccgtcca tgtcgaggcc       540
     gcagccgagg cggctggatg gcactaccgg gtggtgggtg ctccgacgcc ggctgtcgag       600
     gccaacgtcc gctggcttgc cgggtaccgg catccgcggt gtgcctcgag cggattgtcc       660
     tccgtctcgg agtgcttccg catgccgagg cctctggtgg aaggtgtgcg tctgctgggt       720
     gacccgatcg cggtgtggcc tgctgtcttc catgctctgt ggagaggcgt actgagtacg       780
     cctctccaca ggcccctgca cgaacgggcc ctgacggttt cggcatatcc cggtgcgggg       840
     gcccatctgt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page