(data stored in ACNUC7421 zone)

EMBL: AP009493.PE106

AP009493.PE106       Location/Qualifiers
FT   CDS_pept        106026..106295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_106t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_106t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16935"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB2"
FT                   /protein_id="BAG16935.1"
FT                   /translation="MISPLIEIGVMPASLLVQPARPPSPSVWRTHEVARARSPPPLITP
FT                   PFHSVSMLSIRFRRDIVSLHFLTIEPPVAVPVRADAVTTTGPSC"
     ttgatcagtc cgctcatcga gatcggcgtc atgcccgcga gcctcctggt gcagccggct        60
     cggccgccgt ccccatctgt ttggcggact catgaggtgg cccgggcccg tagccctcct       120
     ccactcatca cgcccccgtt ccacagcgtt tccatgcttt ccatcagatt caggagagac       180
     atcgtgtcct tgcatttcct cactatcgaa ccgcctgtcg cagtaccggt gcgagccgac       240
     gctgtcacaa ccaccggtcc ctcatgctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page