(data stored in ACNUC7421 zone)

EMBL: AP009493.PE108

AP009493.PE108       Location/Qualifiers
FT   CDS_pept        107701..108693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_108t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_108t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16937"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB4"
FT                   /protein_id="BAG16937.1"
FT                   /translation="MSLTSNLATVHSPISRFLSLELPAVACLIGDLRSRLPLCPDTVSP
FT                   SPPGPFSYGTLGQAIDLRLRIAFGTPVGSALTSGVTLTAMDMTEARSPEAGRAVAEAGQ
FT                   ELLRLLEAQRPASPGAMLHEPADEDHLARMCFTAGWFEEVYRSALHAGSPLLQADLSRG
FT                   LDGLLNQVPGYVPGDITAMASLADRPEALQWVLRLPAEQRLCGPVFAGSGHVGGADADF
FT                   IASGHLIDCKATIHPKRIGRPQLYQLAGYLLLDYDDSFKVDQVSLYLARQGRLIGWSTE
FT                   EFLRLLGARRSLPELREACRRALSVPDEAPPSVMPRQLRGEQDTLFTDL"
     atgagcctca ccagcaatct cgcaaccgtc cactccccca tctcccggtt tctgagcctg        60
     gaactacccg cggttgcttg tctgatcggc gacctccgat cccgcctgcc gctgtgtccg       120
     gacaccgtca gcccttctcc gccaggcccc ttcagctacg gcaccctggg gcaggccatc       180
     gatctgcgac tgcggatcgc gttcggcaca cctgtgggat cggcgctgac gtccggtgtc       240
     acgctcacgg ccatggatat gaccgaggcc agatctcctg aggcaggccg ggccgtcgcc       300
     gaagcagggc aggaacttct ccggctgctc gaagcacaac gtccggcctc ccccggtgcg       360
     atgctgcacg agcccgccga cgaggatcat ctcgcccgca tgtgcttcac tgccggctgg       420
     ttcgaagagg tctaccgcag tgcgctgcac gccggcagcc ctctcctgca agccgacctc       480
     tcgcgcggac tcgacggtct gctcaaccag gtcccgggct acgtgcccgg tgacatcacc       540
     gcgatggcct ccctcgccga ccgccccgaa gccctgcagt gggtcctccg gcttcccgcc       600
     gagcagcgtc tgtgcggtcc cgtcttcgcc ggcagcggcc atgtcggcgg tgcggacgcc       660
     gactttatcg cgtcgggcca cctcatcgac tgcaaggcca cgattcatcc caagcggatc       720
     ggtaggccgc agctctacca gctcgcggga tatctgctcc ttgactacga cgacagcttc       780
     aaggtcgatc aggtcagtct gtacctggcc cgccagggca gactgatcgg ctggagcacc       840
     gaggagtttc tgcgtctcct gggagctcgc cgctcactac ccgagctgcg ggaagcatgt       900
     cggcgagcgt tgtcggttcc tgatgaggcc ccgccgtcgg tgatgccgcg ccagctccgg       960
     ggtgaacagg acacactgtt caccgatctc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page