(data stored in ACNUC7421 zone)

EMBL: AP009493.PE109

AP009493.PE109       Location/Qualifiers
FT   CDS_pept        complement(108752..109690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_109t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_109t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16938"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB5"
FT                   /protein_id="BAG16938.1"
FT                   /translation="MLRTRATCTEPSANFIDLSTDDLRTLADGSRPLPHADIRRISDTA
FT                   YLQRCSPAVNLIEYLLDADPACRPVLPGERQPLPLDFLQSGAQPTKAITQPIVIRPDQL
FT                   PVIVIDAQDSQQRLDPLHTLRRQRHSIKDRRPRFTDHHRRSCFQPTGPRLLTPQGPSVQ
FT                   NRTGPRVEKTESLRQRGCRQHRKCERVTQIKPLPWSTPKYPLMLTPRRVWPPWSRTAQE
FT                   SEGMTETPPSRKNRTRYEHSQDRFSRKGDVPQRTRPAGLHSSGFTQDTRRGAVAGGEAE
FT                   KFPRHRHEPSPLSQPTESEAPTTVRVSPTRR"
     ttgctgcgga cgcgggctac ctgtaccgaa ccgtcagcga atttcatcga tctcagcacc        60
     gatgatctcc gcaccctcgc ggacggttcc cgccctctgc cgcacgctga catccgccga       120
     atcagcgaca cggcgtacct tcagcgctgc agccctgccg tgaacctcat cgagtacctg       180
     ctcgatgcgg accccgcttg ccggcctgtc ctccccggtg aacgtcagcc tctgcccctc       240
     gacttcctcc agagcggcgc gcaacccacc aaggctataa cgcagccgat cgtcatcaga       300
     cctgatcagc tccctgtgat cgtgatagac gcccaggact cccagcagag actcgatccg       360
     ctgcacacgc tccggcgtca acgccacagc atcaaagaca ggcggcccag gttcaccgac       420
     caccaccgca ggagctgctt ccagcccacc gggccccgcc tcctcacgcc gcagggaccg       480
     tcggtccaga accgcaccgg cccgcgcgta gagaaaaccg aaagcctgcg tcagcgcgga       540
     tgccgccagc acaggaaatg tgaacgcgtc actcaaatca agcccctccc ctggagcaca       600
     ccgaaatacc ccctgatgct cacacctcgc agagtatggc cgccgtggag ccgcacggca       660
     caagaatcag aagggatgac cgaaaccccg ccatcccgaa aaaatcgaac ccgatacgaa       720
     cactctcaag atcgattctc gcgaaaaggt gacgttcccc agcgcacccg ccctgcgggg       780
     ctgcattcgt cggggttcac tcaagacacg aggagaggtg cagttgcagg cggagaggct       840
     gaaaagttcc cgcgccaccg gcacgaaccc agtccactca gtcagccaac ggagagcgaa       900
     gctcctacca cggttcgggt ctccccgact cgtaggtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page