(data stored in ACNUC7421 zone)

EMBL: AP009493.PE11

AP009493.PE11        Location/Qualifiers
FT   CDS_pept        complement(19098..19469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_11t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_11t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16840"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK9"
FT                   /protein_id="BAG16840.1"
FT                   /translation="MRRIRSLRPGSQPQQPVRVSIPRFVGRHLQHSVQLVPGLLVAGVG
FT                   DPLQLAQVASRYRASSQQEPSVHGSLVQQLAQLHDVARCVGEIGQPVQSGLVTLIGQLT
FT                   QGLPVGIHVRHDAMVQPCP"
     atgaggcgga ttcgatcttt gcgtcccgga tcgcagccac agcaaccggt cagagtctca        60
     atccctcggt tcgtcggccg gcaccttcag cactcggtcc agctcgttcc cggcctcctc       120
     gtagccggcg tcggagatcc gttgcagctc gcgcaggtcg ccagccgcta ccgcgcgtcg       180
     agtcagcagg agcccagcgt gcatggatcc ctcgtccagc agctcgctca gctccacgac       240
     gtcgcccgct gcgtcggcga gatcggccag ccggtccaaa gcggtctcgt taccctcatc       300
     ggccagctca cgcagggtct cccggtcggc attcatgttc gtcatgacgc catggtgcaa       360
     ccttgcccct ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page